Protein Family IF05809
Metagenome
Isolate
338
Members
115
Samples
291
Scaffolds
203.43
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_072300|Ga0466707_072300_3524_4270
- Length
- 248 aa
- Sequence
- MYEFILIPQRETPFLHKKHPHPTSIHTLIIYTFAASKKANGMFIKIYPDNPNPKEISKVVQMLQDGGLVIYPTDTVYAMGCDALNIRAVEKICRIKGVNPQKSNLSIICYDLSNISEYAKVSNTIFKLMKRNLPGPFTFILPTGNELPKIYKNRKEVGIRIPDNTIIRELVKGLGNPILTMSIHSEDEVIEYTTDPELIYERYEDAVDVVIDGGYGGMEASTVVDCTKEEAEVIRQGKGELHFPGLSV
Sample Types
Isolate
13.9%
Metagenome
86.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
26.1%
Termitidae
23.4%
Unclassified
13.5%
Kalotermitidae
12.6%
Formicidae
5.4%
Rhinotermitidae
4.5%
Termopsidae
3.6%
Passalidae
2.7%
Culicidae
2.7%
Hydrophilidae
2.7%
Armadillidiidae
0.9%
Hodotermitidae
0.9%
Tenebrionidae
0.9%
Taxonomy
Archaea
1
Bacteria
315
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 3 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 4 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 5 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 6 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 7 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 8 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 9 | 2820013017 | Unclassified Spirochaetes Th196P3bin152 | Isolate | Unclassified |
| 10 | 2820014844 | Unclassified Spirochaetes Nt197P3bin95 | Isolate | Unclassified |
| 11 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 12 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 13 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 14 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 15 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 16 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 17 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 18 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 19 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 20 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 21 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 22 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 23 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 26 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 29 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 30 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 31 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 32 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 33 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 34 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 35 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 36 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 37 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 38 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 39 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 42 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 43 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 44 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 45 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 46 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 47 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 48 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 49 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 50 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 51 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 52 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 53 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 54 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 55 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 56 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 57 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 58 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 59 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 60 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 61 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 62 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 63 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 64 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 65 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 66 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 67 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 68 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 69 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 70 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 71 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 72 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 73 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 74 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 75 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 76 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 77 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 78 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 79 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 80 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 81 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 82 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 83 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 84 | 2820010479 | Unclassified Spirochaetes Th196P4bin55 | Isolate | Unclassified |
| 85 | 2820018428 | Unclassified Spirochaetes Nt197P3bin33 | Isolate | Unclassified |
| 86 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 87 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 88 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 89 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 90 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 91 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 92 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 93 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 94 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 95 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 96 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 97 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 98 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 99 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 100 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 101 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 102 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 103 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 104 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 105 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 106 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 107 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 108 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 109 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 110 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 111 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 112 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 113 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 114 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 115 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_118635 | 3300042659 | Bacteria | 2165 |
| 2 | Ga0466733_133566 | 3300042659 | Bacteria | 2377 |
| 3 | Ga0466733_174982 | 3300042659 | Bacteria | 114252 |
| 4 | Ga0466690_211147 | 3300042590 | Bacteria | 29487 |
| 5 | Ga0466690_310500 | 3300042590 | Unclassified | 10012 |
| 6 | Ga0466692_189353 | 3300042591 | Bacteria | 3609 |
| 7 | Ga0466693_334598 | 3300042592 | Bacteria | 1615 |
| 8 | Ga0466691_011490 | 3300042593 | Bacteria | 6204 |
| 9 | Ga0466695_063866 | 3300042595 | Archaea | 1327 |
| 10 | Ga0466696_313031 | 3300042596 | Bacteria | 30817 |
| 11 | Ga0466696_461447 | 3300042596 | Bacteria | 1699 |
| 12 | Ga0466699_357518 | 3300042597 | Bacteria | 1659 |
| 13 | Ga0466710_076833 | 3300042613 | Bacteria | 8400 |
| 14 | Ga0466710_294363 | 3300042613 | Bacteria | 8608 |
| 15 | Ga0466710_295131 | 3300042613 | Bacteria | 1347 |
| 16 | Ga0466711_386167 | 3300042615 | Bacteria | 5214 |
| 17 | Ga0466711_388540 | 3300042615 | Bacteria | 18549 |
| 18 | Ga0466711_390375 | 3300042615 | Bacteria | 3570 |
| 19 | Ga0466711_480452 | 3300042615 | Bacteria | 5704 |
| 20 | Ga0466715_016411 | 3300042616 | Bacteria | 11047 |
| 21 | Ga0466723_340550 | 3300042618 | Bacteria | 3297 |
| 22 | Ga0123356_10567537 | 3300010049 | Bacteria | 1297 |
| 23 | Ga0123353_10662462 | 3300010167 | Bacteria | 1474 |
| 24 | Ga0123353_10673561 | 3300010167 | Bacteria | 1459 |
| 25 | Ga0466731_016076 | 3300042622 | Bacteria | 12690 |
| 26 | Ga0466735_080221 | 3300042624 | Bacteria | 3589 |
| 27 | Ga0466703_035064 | 3300042636 | Bacteria | 6147 |
| 28 | Ga0466703_097756 | 3300042636 | Bacteria | 20979 |
| 29 | Ga0466703_293791 | 3300042636 | Bacteria | 6057 |
| 30 | Ga0466704_128147 | 3300042643 | Bacteria | 3149 |
| 31 | Ga0466708_196859 | 3300042652 | Bacteria | 9470 |
| 32 | Ga0466708_260349 | 3300042652 | Unclassified | 1296 |
| 33 | Ga0466727_099307 | 3300042655 | Bacteria | 2839 |
| 34 | Ga0466701_102130 | 3300042598 | Bacteria | 13130 |
| 35 | Ga0466706_089371 | 3300042599 | Bacteria | 10559 |
| 36 | Ga0466707_325472 | 3300042601 | Bacteria | 1711 |
| 37 | Ga0466713_066693 | 3300042602 | Bacteria | 1458 |
| 38 | Ga0466713_088446 | 3300042602 | Bacteria | 1557 |
| 39 | Ga0466722_012357 | 3300042609 | Bacteria | 11530 |
| 40 | Ga0466722_024099 | 3300042609 | Bacteria | 30187 |
| 41 | Ga0466722_111476 | 3300042609 | Bacteria | 56871 |
| 42 | JGI24702J35022_10003156 | 3300002462 | Bacteria | 9968 |
| 43 | JGI24702J35022_10011415 | 3300002462 | Bacteria | 4950 |
| 44 | JGI24702J35022_10106377 | 3300002462 | Unclassified | 1540 |
| 45 | Ga0466705_361535 | 3300042612 | Bacteria | 1883 |
| 46 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 47 | Ga0160460_100888 | 3300012845 | Bacteria | 12982 |
| 48 | Ga0160457_1000404 | 3300012858 | Bacteria | 22193 |
| 49 | Ga0466693_347696 | 3300042592 | Bacteria | 3782 |
| 50 | Ga0466696_022759 | 3300042596 | Bacteria | 16362 |
| 51 | Ga0466696_048688 | 3300042596 | Bacteria | 3334 |
| 52 | Ga0466711_151354 | 3300042615 | Bacteria | 9914 |
| 53 | Ga0466711_228872 | 3300042615 | Bacteria | 8842 |
| 54 | Ga0466711_282930 | 3300042615 | Bacteria | 5988 |
| 55 | Ga0466715_030183 | 3300042616 | Bacteria | 13072 |
| 56 | Ga0466715_077842 | 3300042616 | Bacteria | 7124 |
| 57 | Ga0466715_233852 | 3300042616 | Bacteria | 12099 |
| 58 | Ga0466726_420638 | 3300042619 | Bacteria | 1323 |
| 59 | Ga0466728_066896 | 3300042620 | Bacteria | 7357 |
| 60 | Ga0466728_110700 | 3300042620 | Bacteria | 5265 |
| 61 | Ga0466728_374314 | 3300042620 | Unclassified | 6384 |
| 62 | Ga0466728_481678 | 3300042620 | Bacteria | 5583 |
| 63 | Ga0123354_10007269 | 3300010882 | Bacteria | 16629 |
| 64 | Ga0123354_10385735 | 3300010882 | Bacteria | 1204 |
| 65 | Ga0160465_100032 | 3300012803 | Bacteria | 198528 |
| 66 | Ga0466735_128011 | 3300042624 | Bacteria | 1222 |
| 67 | Ga0466703_172298 | 3300042636 | Bacteria | 9679 |
| 68 | Ga0466703_219609 | 3300042636 | Unclassified | 3986 |
| 69 | Ga0466709_287955 | 3300042648 | Bacteria | 134395 |
| 70 | Ga0466706_021806 | 3300042599 | Bacteria | 11800 |
| 71 | Ga0466706_027613 | 3300042599 | Bacteria | 34700 |
| 72 | Ga0466706_052359 | 3300042599 | Bacteria | 50474 |
| 73 | Ga0466713_104777 | 3300042602 | Bacteria | 4872 |
| 74 | Ga0466714_041039 | 3300042603 | Bacteria | 123706 |
| 75 | Ga0466714_115849 | 3300042603 | Bacteria | 1512 |
| 76 | Ga0466716_294723 | 3300042605 | Bacteria | 6095 |
| 77 | Ga0466716_394257 | 3300042605 | Unclassified | 2907 |
| 78 | Ga0466722_153819 | 3300042609 | Bacteria | 6968 |
| 79 | IMNBL1DRAFT_c0003035 | 3300000062 | Bacteria | 11106 |
| 80 | JGI24702J35022_10001300 | 3300002462 | Unclassified | 15538 |
| 81 | Ga0102734_1000281 | 3300007129 | Bacteria | 15692 |
| 82 | Ga0102740_1001347 | 3300007140 | Unclassified | 7913 |
| 83 | Ga0466697_065955 | 3300042611 | Bacteria | 1454 |
| 84 | Ga0466705_242797 | 3300042612 | Bacteria | 2987 |
| 85 | Ga0466705_319284 | 3300042612 | Bacteria | 20383 |
| 86 | Ga0466705_386509 | 3300042612 | Bacteria | 4713 |
| 87 | Ga0265387_1028010 | 3300024582 | Bacteria | 894 |
| 88 | Ga0466690_276500 | 3300042590 | Bacteria | 4913 |
| 89 | Ga0466690_368454 | 3300042590 | Bacteria | 4231 |
| 90 | Ga0466692_074794 | 3300042591 | Bacteria | 46734 |
| 91 | Ga0466692_096905 | 3300042591 | Bacteria | 18961 |
| 92 | Ga0466692_195075 | 3300042591 | Bacteria | 15006 |
| 93 | Ga0466691_120167 | 3300042593 | Bacteria | 4628 |
| 94 | Ga0466694_405025 | 3300042594 | Bacteria | 4974 |
| 95 | Ga0466696_288496 | 3300042596 | Bacteria | 3330 |
| 96 | Ga0466699_325396 | 3300042597 | Bacteria | 1079 |
| 97 | Ga0466705_451251 | 3300042612 | Bacteria | 8758 |
| 98 | Ga0466711_092050 | 3300042615 | Bacteria | 33984 |
| 99 | Ga0466711_140105 | 3300042615 | Bacteria | 4656 |
| 100 | Ga0466723_195990 | 3300042618 | Bacteria | 31997 |
| 101 | Ga0466726_290379 | 3300042619 | Bacteria | 1618 |
| 102 | Ga0123353_10018267 | 3300010167 | Bacteria | 10360 |
| 103 | Ga0466735_096689 | 3300042624 | Bacteria | 3375 |
| 104 | Ga0466703_030934 | 3300042636 | Bacteria | 6584 |
| 105 | Ga0466703_267212 | 3300042636 | Bacteria | 1561 |
| 106 | Ga0466703_334486 | 3300042636 | Bacteria | 4002 |
| 107 | Ga0466704_075089 | 3300042643 | Bacteria | 4478 |
| 108 | Ga0466706_065665 | 3300042599 | Bacteria | 3523 |
| 109 | Ga0466706_142051 | 3300042599 | Bacteria | 39569 |
| 110 | Ga0466713_021655 | 3300042602 | Bacteria | 33701 |
| 111 | Ga0466713_067462 | 3300042602 | Bacteria | 8768 |
| 112 | Ga0466713_092058 | 3300042602 | Unclassified | 7551 |
| 113 | Ga0466717_142253 | 3300042604 | Bacteria | 1281 |
| 114 | Ga0466716_019048 | 3300042605 | Bacteria | 3179 |
| 115 | Ga0466716_272065 | 3300042605 | Bacteria | 3759 |
| 116 | Ga0466722_184944 | 3300042609 | Bacteria | 3076 |
| 117 | 2227189137 | 2225789004 | Bacteria | 7938 |
| 118 | IMNBL1DRAFT_c0002772 | 3300000062 | Bacteria | 11900 |
| 119 | Ga0068302_10188010 | 3300005071 | Bacteria | 5083 |
| 120 | Ga0160470_102456 | 3300012813 | Bacteria | 3491 |
| 121 | Ga0466657_077301 | 3300042582 | Bacteria | 3287 |
| 122 | Ga0466690_049077 | 3300042590 | Bacteria | 3234 |
| 123 | Ga0466690_202922 | 3300042590 | Bacteria | 4955 |
| 124 | Ga0466690_217488 | 3300042590 | Bacteria | 4218 |
| 125 | Ga0466691_018240 | 3300042593 | Bacteria | 13049 |
| 126 | Ga0466696_033214 | 3300042596 | Bacteria | 6100 |
| 127 | Ga0466711_461705 | 3300042615 | Bacteria | 1336 |
| 128 | Ga0466715_349295 | 3300042616 | Bacteria | 45829 |
| 129 | Ga0466723_289517 | 3300042618 | Bacteria | 37052 |
| 130 | Ga0466726_413559 | 3300042619 | Bacteria | 2869 |
| 131 | Ga0466729_061813 | 3300042621 | Bacteria | 13331 |
| 132 | Ga0466729_070787 | 3300042621 | Bacteria | 29335 |
| 133 | Ga0123357_10037687 | 3300009784 | Bacteria | 6582 |
| 134 | Ga0123353_10355167 | 3300010167 | Bacteria | 2206 |
| 135 | Ga0466703_158975 | 3300042636 | Bacteria | 6080 |
| 136 | Ga0466708_179904 | 3300042652 | Bacteria | 2157 |
| 137 | Ga0466725_350213 | 3300042654 | Bacteria | 33385 |
| 138 | Ga0466727_337305 | 3300042655 | Bacteria | 2439 |
| 139 | Ga0466706_095229 | 3300042599 | Bacteria | 1250 |
| 140 | Ga0466706_282773 | 3300042599 | Bacteria | 11809 |
| 141 | Ga0466707_072300 | 3300042601 | Bacteria | 9032 |
| 142 | Ga0466713_043591 | 3300042602 | Bacteria | 53812 |
| 143 | Ga0466713_058081 | 3300042602 | Unclassified | 2178 |
| 144 | Ga0466716_062113 | 3300042605 | Bacteria | 3629 |
| 145 | Ga0466716_155271 | 3300042605 | Bacteria | 3658 |
| 146 | Ga0466719_097366 | 3300042606 | Bacteria | 1706 |
| 147 | Ga0466719_508543 | 3300042606 | Bacteria | 4973 |
| 148 | Ga0466720_100173 | 3300042607 | Bacteria | 3788 |
| 149 | Ga0466721_108741 | 3300042608 | Unclassified | 1252 |
| 150 | Ga0466722_185132 | 3300042609 | Bacteria | 3463 |
| 151 | Ga0466698_383567 | 3300042610 | Bacteria | 1600 |
| 152 | 2227488530 | 2225789004 | Bacteria | 20877 |
| 153 | JGI24705J35276_12234285 | 3300002504 | Bacteria | 5394 |
| 154 | Ga0466697_146427 | 3300042611 | Unclassified | 1033 |
| 155 | Ga0466732_316101 | 3300042656 | Unclassified | 2083 |
| 156 | Ga0466733_112889 | 3300042659 | Bacteria | 111775 |
| 157 | Ga0466733_168074 | 3300042659 | Bacteria | 31478 |
| 158 | Ga0466694_151319 | 3300042594 | Bacteria | 1773 |
| 159 | Ga0466696_122515 | 3300042596 | Bacteria | 1216 |
| 160 | Ga0466715_411459 | 3300042616 | Bacteria | 20369 |
| 161 | Ga0466723_005799 | 3300042618 | Bacteria | 5693 |
| 162 | Ga0466728_204518 | 3300042620 | Bacteria | 23015 |
| 163 | Ga0466730_029816 | 3300042625 | Unclassified | 1545 |
| 164 | Ga0466704_128567 | 3300042643 | Bacteria | 6705 |
| 165 | Ga0466707_041956 | 3300042601 | Bacteria | 33293 |
| 166 | Ga0466707_403795 | 3300042601 | Bacteria | 1410 |
| 167 | Ga0466713_003715 | 3300042602 | Bacteria | 18997 |
| 168 | Ga0466713_068672 | 3300042602 | Bacteria | 133468 |
| 169 | Ga0466713_092991 | 3300042602 | Bacteria | 3038 |
| 170 | Ga0466716_359691 | 3300042605 | Bacteria | 3199 |
| 171 | Ga0466722_168457 | 3300042609 | Bacteria | 3787 |
| 172 | Ga0466698_179271 | 3300042610 | Bacteria | 2941 |
| 173 | Ga0466697_056567 | 3300042611 | Bacteria | 485126 |
| 174 | 2227078003 | 2225789003 | Bacteria | 10139 |
| 175 | IMNBL1DRAFT_c0003501 | 3300000062 | Bacteria | 10048 |
| 176 | Ga0068305_10029364 | 3300005083 | Unclassified | 4823 |
| 177 | Ga0103268_1000283 | 3300007192 | Bacteria | 16542 |
| 178 | Ga0123357_10001839 | 3300009784 | Bacteria | 23020 |
| 179 | Ga0466697_185819 | 3300042611 | Bacteria | 1014 |
| 180 | Ga0466733_053829 | 3300042659 | Bacteria | 74295 |
| 181 | Ga0160472_101608 | 3300012839 | Bacteria | 6267 |
| 182 | Ga0264413_142629 | 3300024493 | Bacteria | 2696 |
| 183 | Ga0466690_024508 | 3300042590 | Bacteria | 13532 |
| 184 | Ga0466696_315444 | 3300042596 | Bacteria | 4107 |
| 185 | Ga0466715_366763 | 3300042616 | Bacteria | 15903 |
| 186 | Ga0466715_521826 | 3300042616 | Bacteria | 60910 |
| 187 | Ga0466723_107508 | 3300042618 | Bacteria | 10254 |
| 188 | Ga0466723_196835 | 3300042618 | Bacteria | 5325 |
| 189 | Ga0466723_262728 | 3300042618 | Bacteria | 1871 |
| 190 | Ga0466726_073657 | 3300042619 | Bacteria | 9894 |
| 191 | Ga0466728_218330 | 3300042620 | Bacteria | 8782 |
| 192 | Ga0123353_10003788 | 3300010167 | Bacteria | 19276 |
| 193 | Ga0123353_10944125 | 3300010167 | Bacteria | 1168 |
| 194 | Ga0123354_10494807 | 3300010882 | Bacteria | 957 |
| 195 | Ga0466735_150056 | 3300042624 | Bacteria | 2906 |
| 196 | Ga0466703_098785 | 3300042636 | Bacteria | 12923 |
| 197 | Ga0466704_020625 | 3300042643 | Bacteria | 14334 |
| 198 | Ga0466704_554600 | 3300042643 | Bacteria | 11294 |
| 199 | Ga0466709_286585 | 3300042648 | Bacteria | 5498 |
| 200 | Ga0466708_055317 | 3300042652 | Bacteria | 25812 |
| 201 | Ga0466708_125531 | 3300042652 | Bacteria | 21166 |
| 202 | Ga0466725_197851 | 3300042654 | Bacteria | 2018 |
| 203 | Ga0466706_015916 | 3300042599 | Bacteria | 2611 |
| 204 | Ga0466706_212283 | 3300042599 | Bacteria | 5799 |
| 205 | Ga0466707_029130 | 3300042601 | Bacteria | 12036 |
| 206 | Ga0466713_091714 | 3300042602 | Bacteria | 189911 |
| 207 | Ga0466719_212614 | 3300042606 | Bacteria | 8664 |
| 208 | Ga0466720_031507 | 3300042607 | Bacteria | 1471 |
| 209 | Ga0466722_035651 | 3300042609 | Bacteria | 10750 |
| 210 | Ga0466722_183321 | 3300042609 | Bacteria | 16484 |
| 211 | 2227621024 | 2225789004 | Unclassified | 2188 |
| 212 | IMNBL1DRAFT_c0005756 | 3300000062 | Bacteria | 6978 |
| 213 | IMNBL1DRAFT_c0029601 | 3300000062 | Unclassified | 2023 |
| 214 | Ga0102735_1000150 | 3300007080 | Bacteria | 18264 |
| 215 | Ga0103268_1000073 | 3300007192 | Bacteria | 30980 |
| 216 | Ga0466697_094477 | 3300042611 | Bacteria | 2646 |
| 217 | Ga0466705_094399 | 3300042612 | Bacteria | 7676 |
| 218 | Ga0466732_224001 | 3300042656 | Bacteria | 1038 |
| 219 | Ga0466732_428314 | 3300042656 | Bacteria | 3886 |
| 220 | Ga0466733_010054 | 3300042659 | Bacteria | 17175 |
| 221 | Ga0265387_1006284 | 3300024582 | Bacteria | 1596 |
| 222 | Ga0466657_237423 | 3300042582 | Bacteria | 49323 |
| 223 | Ga0466690_092200 | 3300042590 | Bacteria | 1256 |
| 224 | Ga0466690_418553 | 3300042590 | Bacteria | 1439 |
| 225 | Ga0466692_163833 | 3300042591 | Bacteria | 33109 |
| 226 | Ga0466691_162886 | 3300042593 | Bacteria | 3696 |
| 227 | Ga0466696_410605 | 3300042596 | Bacteria | 1574 |
| 228 | Ga0466711_008907 | 3300042615 | Bacteria | 18797 |
| 229 | Ga0466711_052732 | 3300042615 | Unclassified | 9598 |
| 230 | Ga0466723_158172 | 3300042618 | Bacteria | 24390 |
| 231 | Ga0466726_081477 | 3300042619 | Bacteria | 1689 |
| 232 | Ga0466728_166609 | 3300042620 | Bacteria | 18694 |
| 233 | Ga0466728_449547 | 3300042620 | Bacteria | 1327 |
| 234 | Ga0123357_10201430 | 3300009784 | Bacteria | 2264 |
| 235 | Ga0123356_10022106 | 3300010049 | Bacteria | 6007 |
| 236 | Ga0123353_10105754 | 3300010167 | Bacteria | 4535 |
| 237 | Ga0123354_10123777 | 3300010882 | Bacteria | 3319 |
| 238 | Ga0466734_058656 | 3300042623 | Bacteria | 1854 |
| 239 | Ga0466704_091000 | 3300042643 | Bacteria | 7404 |
| 240 | Ga0466708_427072 | 3300042652 | Bacteria | 12759 |
| 241 | Ga0466727_123703 | 3300042655 | Bacteria | 13736 |
| 242 | Ga0466727_283567 | 3300042655 | Bacteria | 2383 |
| 243 | Ga0466701_090397 | 3300042598 | Unclassified | 2150 |
| 244 | Ga0466707_403501 | 3300042601 | Bacteria | 1155 |
| 245 | Ga0466713_135928 | 3300042602 | Bacteria | 2673 |
| 246 | Ga0466714_012910 | 3300042603 | Bacteria | 1087 |
| 247 | Ga0466717_194360 | 3300042604 | Unclassified | 1207 |
| 248 | Ga0466722_174599 | 3300042609 | Bacteria | 13797 |
| 249 | Ga0466722_253025 | 3300042609 | Bacteria | 1577 |
| 250 | IMNBL1DRAFT_c0000770 | 3300000062 | Bacteria | 25331 |
| 251 | IMNBL1DRAFT_c0045708 | 3300000062 | Bacteria | 1427 |
| 252 | JGI24696J40584_12864252 | 3300002834 | Bacteria | 1022 |
| 253 | CVPL010W_10000486 | 3300002931 | Bacteria | 41930 |
| 254 | Ga0068302_10251038 | 3300005071 | Bacteria | 1348 |
| 255 | Ga0072941_1376998 | 3300005201 | Bacteria | 1326 |
| 256 | Ga0103267_1000012 | 3300007190 | Bacteria | 65954 |
| 257 | Ga0103267_1000090 | 3300007190 | Bacteria | 34248 |
| 258 | Ga0123357_10000729 | 3300009784 | Bacteria | 33109 |
| 259 | Ga0466733_086557 | 3300042659 | Bacteria | 7051 |
| 260 | Ga0466733_093794 | 3300042659 | Bacteria | 1300 |
| 261 | Ga0466733_119077 | 3300042659 | Bacteria | 2327 |
| 262 | Ga0466692_051324 | 3300042591 | Bacteria | 3306 |
| 263 | Ga0466691_046490 | 3300042593 | Bacteria | 17279 |
| 264 | Ga0466691_138601 | 3300042593 | Bacteria | 4682 |
| 265 | Ga0466696_097329 | 3300042596 | Bacteria | 10716 |
| 266 | Ga0466696_102352 | 3300042596 | Bacteria | 2890 |
| 267 | Ga0466696_223030 | 3300042596 | Bacteria | 5306 |
| 268 | Ga0466711_191512 | 3300042615 | Bacteria | 16567 |
| 269 | Ga0466726_342792 | 3300042619 | Bacteria | 1659 |
| 270 | Ga0123357_10012444 | 3300009784 | Bacteria | 10980 |
| 271 | Ga0123357_10173735 | 3300009784 | Bacteria | 2540 |
| 272 | Ga0123356_11479948 | 3300010049 | Bacteria | 837 |
| 273 | Ga0466731_425072 | 3300042622 | Unclassified | 1089 |
| 274 | Ga0466735_010132 | 3300042624 | Bacteria | 1732 |
| 275 | Ga0466704_322237 | 3300042643 | Bacteria | 14224 |
| 276 | Ga0466709_191268 | 3300042648 | Bacteria | 9993 |
| 277 | Ga0466727_198839 | 3300042655 | Bacteria | 8514 |
| 278 | Ga0466727_347931 | 3300042655 | Bacteria | 6360 |
| 279 | Ga0466706_127998 | 3300042599 | Bacteria | 35830 |
| 280 | Ga0466707_222762 | 3300042601 | Bacteria | 2346 |
| 281 | Ga0466713_025060 | 3300042602 | Bacteria | 48276 |
| 282 | Ga0466713_122611 | 3300042602 | Bacteria | 62960 |
| 283 | Ga0466714_011815 | 3300042603 | Bacteria | 5689 |
| 284 | Ga0466719_153002 | 3300042606 | Bacteria | 1410 |
| 285 | Ga0466722_124822 | 3300042609 | Bacteria | 6907 |
| 286 | Ga0466697_029870 | 3300042611 | Unclassified | 2900 |
| 287 | 2227100248 | 2225789004 | Bacteria | 9634 |
| 288 | JGI24702J35022_10134177 | 3300002462 | Bacteria | 1376 |
| 289 | JGI24696J40584_12815042 | 3300002834 | Bacteria | 896 |
| 290 | Ga0068305_11114863 | 3300005083 | Bacteria | 793 |
| 291 | Ga0103267_1000807 | 3300007190 | Bacteria | 13760 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01300 | Sua5_yciO_yrdC | Telomere recombination | 61 | 237 | 0.94 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01300 | GO:0003725 | double-stranded RNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.