Protein Family IF05804
Metagenome
Isolate
212
Members
109
Samples
150
Scaffolds
363.53
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_065627|Ga0466707_065627_129_1391
- Length
- 420 aa
- Sequence
- MTGFVPTTYDRGCIDDRVCHSVQGEAAVTESIEATRKEDYMNYRIAVIRGDGIGPEITDQAIKALDAVSRKFGHQFNYNYLLAGGAALNEHGIPLPAETVEACKESNAVLLGAVGDPKWDNEPGSNRPEIAILGLREQLGLFVNLRPALIFPQLASASPLKAEIINGALDILIVRELTGGIYFGPRGTGEIAQGVISDAIMSKFPKIAQGLQPDGRVAYDVEIYHDYEIRRIAHTAFELARKRNKRLTSVDKANVLDSSRLWRAVMEEVSSSYPDVTLDHLFVDNTTQQLIKDPKQFDVIVTSNMFGDIISDEASQITGSIGMLPSASLGEGSFGLYEPIHGSAPKYTGLDRANPIATILSVSMLLRYSLALKEEADAVEIAISAFLSEGYRTPDIFTGEDGQQKVGTQETGDRIAEFIK
Sample Types
Isolate
29.2%
Metagenome
70.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
31.8%
Termitidae
17.8%
Apidae
15.0%
Kalotermitidae
9.3%
Blattidae
7.5%
Tenebrionidae
3.7%
Rhinotermitidae
2.8%
Termopsidae
2.8%
Passalidae
1.9%
Elmidae
1.9%
Pseudococcidae
0.9%
Calliphoridae
0.9%
Hodotermitidae
0.9%
Drosophilidae
0.9%
Harpacticidae
0.9%
Tryonicidae
0.9%
Taxonomy
Archaea
0
Bacteria
208
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 9 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 10 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 11 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 12 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 13 | 2940352027 | Breznakia sp. PH1-1 | Isolate | Blattidae |
| 14 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 21 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 22 | 650716018 | Candidatus Tremblaya princeps PCIT | Isolate | Pseudococcidae |
| 23 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 24 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 25 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 26 | 2791354839 | Unclassified Chloroflexi Co191P4bin10 | Isolate | Unclassified |
| 27 | 2791354849 | Unclassified Chloroflexi Lab288P3bin29 | Isolate | Unclassified |
| 28 | 2820254385 | Unclassified Firmicutes Th196P3bin54 | Isolate | Unclassified |
| 29 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 30 | 2940356891 | Breznakia sp. PFB1-11 | Isolate | Blattidae |
| 31 | 2940364193 | Breznakia sp. PFB1-19 | Isolate | Blattidae |
| 32 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 33 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 34 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 35 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 40 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 41 | 2791354848 | Unclassified Chloroflexi Emb289P3bin155 | Isolate | Unclassified |
| 42 | 2820263778 | Unclassified Firmicutes Th196P3bin37 | Isolate | Unclassified |
| 43 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 44 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 45 | 2940368928 | Breznakia sp. PFB2-30 | Isolate | Blattidae |
| 46 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 47 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 48 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 49 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 50 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 51 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 52 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 55 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 56 | 2820569216 | Unclassified Firmicutes Emb289P3bin33 | Isolate | Unclassified |
| 57 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 58 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 59 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 60 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 61 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 62 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 63 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 64 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 65 | 2940361758 | Breznakia sp. PFB1-14 | Isolate | Blattidae |
| 66 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 67 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 68 | 2820610792 | Unclassified Firmicutes Emb289P1bin33 | Isolate | Unclassified |
| 69 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 70 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 71 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 72 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 73 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 74 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 75 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 76 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 77 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 78 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 79 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 80 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 81 | 2021593000 | Sample 264 | Metagenome | Harpacticidae |
| 82 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 83 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 84 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 85 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 86 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 87 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 88 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 89 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 90 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 91 | 2940359323 | Breznakia sp. PFB1-12 | Isolate | Blattidae |
| 92 | 2940366561 | Breznakia sp. PFB1-4 | Isolate | Blattidae |
| 93 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 94 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 95 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 96 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 97 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 98 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 99 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 100 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 101 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 102 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 103 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 104 | 2820731983 | Unclassified Chloroflexi Nt197P3bin126 | Isolate | Unclassified |
| 105 | 2820734335 | Unclassified Chloroflexi Lab288P3bin99 | Isolate | Unclassified |
| 106 | 2940354458 | Breznakia sp. PF1-11 | Isolate | Blattidae |
| 107 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 108 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 109 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10065850 | 3300010049 | Bacteria | 3391 |
| 2 | Ga0123354_10001360 | 3300010882 | Bacteria | 29369 |
| 3 | Ga0123354_10042200 | 3300010882 | Bacteria | 7036 |
| 4 | Ga0123354_10100213 | 3300010882 | Bacteria | 3922 |
| 5 | Ga0068302_10034574 | 3300005071 | Bacteria | 4135 |
| 6 | Ga0466702_185807 | 3300042635 | Bacteria | 8249 |
| 7 | Ga0466703_215712 | 3300042636 | Bacteria | 4145 |
| 8 | Ga0466703_347053 | 3300042636 | Bacteria | 9715 |
| 9 | Ga0466701_086174 | 3300042598 | Bacteria | 1984 |
| 10 | Ga0466706_053055 | 3300042599 | Bacteria | 1810 |
| 11 | Ga0466706_074539 | 3300042599 | Bacteria | 137679 |
| 12 | Ga0466707_326632 | 3300042601 | Bacteria | 20421 |
| 13 | Ga0466714_027868 | 3300042603 | Bacteria | 19878 |
| 14 | Ga0466722_047277 | 3300042609 | Bacteria | 2392 |
| 15 | Ga0123353_10197487 | 3300010167 | Bacteria | 3169 |
| 16 | 2227619044 | 2225789004 | Bacteria | 46937 |
| 17 | JGI24696J40584_12955148 | 3300002834 | Bacteria | 2774 |
| 18 | Ga0415639_015764 | 3300038395 | Bacteria | 3057 |
| 19 | Ga0466691_070376 | 3300042593 | Bacteria | 12014 |
| 20 | Ga0466696_080555 | 3300042596 | Bacteria | 2183 |
| 21 | Ga0466705_350255 | 3300042612 | Bacteria | 7423 |
| 22 | Ga0466729_208557 | 3300042621 | Bacteria | 3707 |
| 23 | Ga0466706_003683 | 3300042599 | Bacteria | 1678 |
| 24 | Ga0466706_084230 | 3300042599 | Bacteria | 11441 |
| 25 | Ga0466707_182732 | 3300042601 | Bacteria | 22439 |
| 26 | Ga0466713_010848 | 3300042602 | Bacteria | 5718 |
| 27 | Ga0466722_235316 | 3300042609 | Bacteria | 15098 |
| 28 | Ga0466728_028360 | 3300042620 | Bacteria | 2468 |
| 29 | Ga0123356_10007475 | 3300010049 | Bacteria | 10900 |
| 30 | Ga0123353_10000472 | 3300010167 | Bacteria | 49913 |
| 31 | Ga0123353_10017113 | 3300010167 | Bacteria | 10634 |
| 32 | Ga0123353_10470822 | 3300010167 | Bacteria | 1842 |
| 33 | Ga0562379_0086 | 3300056790 | Bacteria | 339972 |
| 34 | Ga0562379_0663 | 3300056790 | Bacteria | 59779 |
| 35 | Ga0562378_3485 | 3300056814 | Bacteria | 9317 |
| 36 | Ga0562375_0322 | 3300056856 | Bacteria | 114179 |
| 37 | HBC_ctgsDRAFT_1004426 | 3300000333 | Bacteria | 3255 |
| 38 | Ga0466729_272174 | 3300042621 | Bacteria | 94053 |
| 39 | Ga0466731_012042 | 3300042622 | Bacteria | 3142 |
| 40 | Ga0466704_202975 | 3300042643 | Bacteria | 7054 |
| 41 | Ga0466708_454360 | 3300042652 | Bacteria | 14313 |
| 42 | Ga0466706_138301 | 3300042599 | Bacteria | 29290 |
| 43 | Ga0466707_087461 | 3300042601 | Bacteria | 1711 |
| 44 | Ga0466707_257437 | 3300042601 | Bacteria | 4318 |
| 45 | Ga0466707_309381 | 3300042601 | Bacteria | 29890 |
| 46 | Ga0466719_517374 | 3300042606 | Bacteria | 7066 |
| 47 | Ga0466697_007008 | 3300042611 | Bacteria | 6055 |
| 48 | Ga0466715_598265 | 3300042616 | Bacteria | 45969 |
| 49 | Ga0466729_063683 | 3300042621 | Bacteria | 5458 |
| 50 | Ga0123355_10086854 | 3300009826 | Bacteria | 4973 |
| 51 | Ga0123355_10148233 | 3300009826 | Bacteria | 3571 |
| 52 | Ga0123353_10000639 | 3300010167 | Bacteria | 42789 |
| 53 | Ga0123354_10171747 | 3300010882 | Bacteria | 2519 |
| 54 | Ga0466733_082697 | 3300042659 | Bacteria | 8091 |
| 55 | Ga0466705_281128 | 3300042612 | Bacteria | 4794 |
| 56 | Ga0466702_149298 | 3300042635 | Bacteria | 11402 |
| 57 | Ga0466709_130801 | 3300042648 | Bacteria | 11118 |
| 58 | Ga0466708_314773 | 3300042652 | Bacteria | 5624 |
| 59 | Ga0466706_128132 | 3300042599 | Bacteria | 2786 |
| 60 | Ga0466706_180927 | 3300042599 | Unclassified | 1977 |
| 61 | Ga0466706_186078 | 3300042599 | Bacteria | 13472 |
| 62 | Ga0466707_139165 | 3300042601 | Bacteria | 8549 |
| 63 | Ga0466707_395840 | 3300042601 | Bacteria | 10573 |
| 64 | Ga0466713_059769 | 3300042602 | Bacteria | 172763 |
| 65 | Ga0466717_228332 | 3300042604 | Bacteria | 4375 |
| 66 | Ga0466719_325554 | 3300042606 | Bacteria | 1651 |
| 67 | Ga0466721_120073 | 3300042608 | Bacteria | 87856 |
| 68 | Ga0466722_128488 | 3300042609 | Bacteria | 5945 |
| 69 | Ga0466715_102478 | 3300042616 | Bacteria | 5990 |
| 70 | Ga0123353_10005319 | 3300010167 | Bacteria | 16859 |
| 71 | Ga0123353_10157977 | 3300010167 | Bacteria | 3612 |
| 72 | Ga0466733_034477 | 3300042659 | Bacteria | 6402 |
| 73 | Ga0562379_1401 | 3300056790 | Unclassified | 27800 |
| 74 | Ga0068302_10123216 | 3300005071 | Bacteria | 4821 |
| 75 | Ga0415639_001032 | 3300038395 | Bacteria | 50780 |
| 76 | Ga0466696_247208 | 3300042596 | Bacteria | 20111 |
| 77 | Ga0466730_060719 | 3300042625 | Bacteria | 4392 |
| 78 | Ga0466702_283126 | 3300042635 | Bacteria | 2107 |
| 79 | Ga0466727_295644 | 3300042655 | Bacteria | 11146 |
| 80 | Ga0466706_040007 | 3300042599 | Bacteria | 4321 |
| 81 | Ga0466706_060587 | 3300042599 | Bacteria | 19790 |
| 82 | Ga0466700_321138 | 3300042600 | Bacteria | 3777 |
| 83 | Ga0466707_014811 | 3300042601 | Bacteria | 2435 |
| 84 | Ga0466707_065627 | 3300042601 | Bacteria | 2785 |
| 85 | Ga0466707_089517 | 3300042601 | Bacteria | 3905 |
| 86 | Ga0466707_130052 | 3300042601 | Unclassified | 3541 |
| 87 | Ga0466719_137037 | 3300042606 | Bacteria | 2806 |
| 88 | Ga0466715_580171 | 3300042616 | Bacteria | 2570 |
| 89 | Ga0466726_095100 | 3300042619 | Bacteria | 18706 |
| 90 | Ga0466728_100289 | 3300042620 | Bacteria | 3291 |
| 91 | Ga0123356_10005547 | 3300010049 | Bacteria | 12831 |
| 92 | Ga0123353_10010268 | 3300010167 | Bacteria | 13033 |
| 93 | Ga0123353_10081464 | 3300010167 | Bacteria | 5205 |
| 94 | Ga0123353_10142568 | 3300010167 | Bacteria | 3836 |
| 95 | Ga0123353_10152602 | 3300010167 | Bacteria | 3686 |
| 96 | Ga0123353_10240592 | 3300010167 | Bacteria | 2812 |
| 97 | Ga0123353_10646154 | 3300010167 | Bacteria | 1499 |
| 98 | Ga0562379_0197 | 3300056790 | Bacteria | 172310 |
| 99 | Ga0562375_0035 | 3300056856 | Bacteria | 623265 |
| 100 | Ga0562376_3663 | 3300056857 | Bacteria | 14911 |
| 101 | Ga0072941_1172871 | 3300005201 | Bacteria | 5423 |
| 102 | Ga0466705_204234 | 3300042612 | Bacteria | 1336 |
| 103 | Ga0466703_241994 | 3300042636 | Bacteria | 15098 |
| 104 | Ga0466709_143484 | 3300042648 | Bacteria | 162355 |
| 105 | Ga0466709_418873 | 3300042648 | Bacteria | 1371 |
| 106 | Ga0466727_081063 | 3300042655 | Bacteria | 4506 |
| 107 | Ga0466706_033285 | 3300042599 | Bacteria | 29422 |
| 108 | Ga0466706_084925 | 3300042599 | Bacteria | 9302 |
| 109 | Ga0466706_259049 | 3300042599 | Bacteria | 2492 |
| 110 | Ga0466707_015229 | 3300042601 | Bacteria | 11446 |
| 111 | Ga0466707_302630 | 3300042601 | Bacteria | 16423 |
| 112 | Ga0466707_403875 | 3300042601 | Bacteria | 1747 |
| 113 | Ga0466713_104478 | 3300042602 | Bacteria | 40990 |
| 114 | Ga0466726_010011 | 3300042619 | Bacteria | 21762 |
| 115 | Ga0466728_106643 | 3300042620 | Bacteria | 1696 |
| 116 | Ga0123355_10005156 | 3300009826 | Bacteria | 19066 |
| 117 | Ga0123356_10059264 | 3300010049 | Bacteria | 3571 |
| 118 | Ga0123353_10511671 | 3300010167 | Bacteria | 1745 |
| 119 | Ga0123353_10616873 | 3300010167 | Bacteria | 1545 |
| 120 | Ga0123354_10091752 | 3300010882 | Bacteria | 4192 |
| 121 | TM1208_contig09883 | 2021593000 | Bacteria | 4878 |
| 122 | Ga0415639_087258 | 3300038395 | Bacteria | 17355 |
| 123 | Ga0466692_098064 | 3300042591 | Bacteria | 34854 |
| 124 | Ga0466705_005010 | 3300042612 | Bacteria | 3125 |
| 125 | Ga0466705_169803 | 3300042612 | Bacteria | 1378 |
| 126 | Ga0466703_222221 | 3300042636 | Bacteria | 13603 |
| 127 | Ga0466704_023380 | 3300042643 | Bacteria | 18349 |
| 128 | Ga0466709_204281 | 3300042648 | Bacteria | 65501 |
| 129 | Ga0466727_292682 | 3300042655 | Bacteria | 13670 |
| 130 | Ga0466706_005335 | 3300042599 | Bacteria | 2177 |
| 131 | Ga0466706_053813 | 3300042599 | Bacteria | 8591 |
| 132 | Ga0466706_207446 | 3300042599 | Bacteria | 3649 |
| 133 | Ga0466706_220959 | 3300042599 | Bacteria | 6027 |
| 134 | Ga0466717_254121 | 3300042604 | Bacteria | 3035 |
| 135 | Ga0466719_051932 | 3300042606 | Bacteria | 2981 |
| 136 | Ga0466726_251481 | 3300042619 | Bacteria | 2423 |
| 137 | Ga0123357_10029676 | 3300009784 | Bacteria | 7412 |
| 138 | Ga0123353_10430616 | 3300010167 | Unclassified | 1951 |
| 139 | Ga0466733_082358 | 3300042659 | Bacteria | 5067 |
| 140 | Ga0562378_0075 | 3300056814 | Bacteria | 280321 |
| 141 | IMNBL1DRAFT_c0000879 | 3300000062 | Bacteria | 23426 |
| 142 | IMNBL1DRAFT_c0014340 | 3300000062 | Bacteria | 3503 |
| 143 | Ga0068305_10004611 | 3300005083 | Bacteria | 44502 |
| 144 | Ga0104048_1171226 | 3300007143 | Bacteria | 1524 |
| 145 | Ga0123357_10000246 | 3300009784 | Bacteria | 51630 |
| 146 | Ga0123357_10000408 | 3300009784 | Bacteria | 40971 |
| 147 | Ga0466734_169040 | 3300042623 | Bacteria | 3898 |
| 148 | Ga0466706_218910 | 3300042599 | Bacteria | 6766 |
| 149 | Ga0466713_004881 | 3300042602 | Bacteria | 88322 |
| 150 | Ga0466718_106912 | 3300042617 | Bacteria | 1058 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00180 | Iso_dh | Isocitrate/isopropylmalate dehydrogenase | 45 | 415 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.