Protein Family IF05780
Metagenome
Isolate
117
Members
45
Samples
113
Scaffolds
284.21
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_026849|Ga0466707_026849_28284_29147
- Length
- 260 aa
- Sequence
- MFGLFDKISNWFRGLLLEGILSNFTGMFEEVNSKVREIAEQVGQTPQGWNGSIFSLIRTLSETVIIPVAGMILTFVLCYELITMVIEKNNMADFDTFIIYKWIFKTFVAVFILTHTFDIVMGVFSLAQHVVNGSAGIIGSRLDMSLALDQLQLQLVVMGTGELIGLFLESMCSIAPIPFSTMVNREWGHIGNSYLKSLFALAFQGFLIMVCVAIYAILLQTITAAGNIHAAIWGCAGYTVLLCFTLFKTGSLSKSIFGAH
Sample Types
Isolate
3.4%
Metagenome
96.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
52.3%
Kalotermitidae
18.2%
Unclassified
9.1%
Rhinotermitidae
6.8%
Termopsidae
6.8%
Passalidae
4.5%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
101
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 10 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 11 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 12 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 13 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 14 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 15 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 16 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 2820520043 | Unclassified Firmicutes Lab288P1bin24 | Isolate | Unclassified |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 21 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 24 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 25 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 26 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 27 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 28 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 29 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 30 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_159805 | 3300042611 | Bacteria | 2492 |
| 2 | Ga0123357_10169632 | 3300009784 | Unclassified | 2586 |
| 3 | Ga0123355_10239845 | 3300009826 | Unclassified | 2571 |
| 4 | Ga0123356_10045854 | 3300010049 | Bacteria | 4067 |
| 5 | Ga0123354_10182718 | 3300010882 | Bacteria | 2386 |
| 6 | Ga0123354_10361792 | 3300010882 | Bacteria | 1278 |
| 7 | Ga0466693_118594 | 3300042592 | Bacteria | 2768 |
| 8 | Ga0466691_193600 | 3300042593 | Bacteria | 2679 |
| 9 | Ga0466704_195512 | 3300042643 | Bacteria | 47275 |
| 10 | Ga0466725_182797 | 3300042654 | Bacteria | 1266 |
| 11 | Ga0072941_1057583 | 3300005201 | Bacteria | 4366 |
| 12 | Ga0466707_026849 | 3300042601 | Bacteria | 29537 |
| 13 | Ga0466707_216613 | 3300042601 | Bacteria | 4591 |
| 14 | Ga0466707_422910 | 3300042601 | Bacteria | 1261 |
| 15 | Ga0466714_046605 | 3300042603 | Bacteria | 2985 |
| 16 | Ga0466722_129021 | 3300042609 | Bacteria | 12138 |
| 17 | Ga0466698_170624 | 3300042610 | Bacteria | 1672 |
| 18 | Ga0123357_10462134 | 3300009784 | Bacteria | 1090 |
| 19 | Ga0123355_10213002 | 3300009826 | Bacteria | 2796 |
| 20 | Ga0123354_10293098 | 3300010882 | Bacteria | 1555 |
| 21 | Ga0415639_018690 | 3300038395 | Bacteria | 4985 |
| 22 | 2227101932 | 2225789004 | Bacteria | 1787 |
| 23 | Ga0466714_094839 | 3300042603 | Bacteria | 1187 |
| 24 | Ga0466698_046456 | 3300042610 | Bacteria | 1239 |
| 25 | Ga0466705_450831 | 3300042612 | Bacteria | 1991 |
| 26 | Ga0466728_102147 | 3300042620 | Bacteria | 2155 |
| 27 | Ga0123357_10055386 | 3300009784 | Bacteria | 5339 |
| 28 | Ga0123355_10257895 | 3300009826 | Unclassified | 2443 |
| 29 | Ga0123355_10363873 | 3300009826 | Bacteria | 1902 |
| 30 | Ga0123356_10039978 | 3300010049 | Bacteria | 4370 |
| 31 | Ga0415639_047141 | 3300038395 | Unclassified | 18367 |
| 32 | Ga0466693_000993 | 3300042592 | Bacteria | 3610 |
| 33 | Ga0466693_223500 | 3300042592 | Bacteria | 3170 |
| 34 | Ga0466694_023995 | 3300042594 | Bacteria | 2219 |
| 35 | Ga0466725_202456 | 3300042654 | Bacteria | 2497 |
| 36 | Ga0466700_353354 | 3300042600 | Bacteria | 1914 |
| 37 | Ga0466714_027891 | 3300042603 | Bacteria | 1331 |
| 38 | Ga0466714_038277 | 3300042603 | Bacteria | 66966 |
| 39 | Ga0466714_149303 | 3300042603 | Bacteria | 4868 |
| 40 | Ga0466722_212160 | 3300042609 | Bacteria | 31192 |
| 41 | Ga0466698_172300 | 3300042610 | Bacteria | 2625 |
| 42 | Ga0466733_180479 | 3300042659 | Bacteria | 3669 |
| 43 | Ga0123357_10078039 | 3300009784 | Bacteria | 4365 |
| 44 | Ga0123357_10363624 | 3300009784 | Unclassified | 1366 |
| 45 | Ga0123355_10168945 | 3300009826 | Bacteria | 3274 |
| 46 | Ga0123355_10758187 | 3300009826 | Bacteria | 1095 |
| 47 | Ga0123356_10083274 | 3300010049 | Bacteria | 3030 |
| 48 | Ga0123356_10101408 | 3300010049 | Bacteria | 2762 |
| 49 | Ga0123356_10171575 | 3300010049 | Bacteria | 2180 |
| 50 | Ga0123353_10610814 | 3300010167 | Bacteria | 1556 |
| 51 | Ga0466703_424517 | 3300042636 | Bacteria | 1849 |
| 52 | Ga0466714_138940 | 3300042603 | Bacteria | 1123 |
| 53 | Ga0466716_418756 | 3300042605 | Bacteria | 7755 |
| 54 | Ga0466719_048831 | 3300042606 | Bacteria | 6113 |
| 55 | Ga0466705_239119 | 3300042612 | Bacteria | 17091 |
| 56 | Ga0123356_10068296 | 3300010049 | Bacteria | 3329 |
| 57 | Ga0123356_10270998 | 3300010049 | Bacteria | 1787 |
| 58 | Ga0123353_10013207 | 3300010167 | Bacteria | 11813 |
| 59 | Ga0123353_10162388 | 3300010167 | Bacteria | 3555 |
| 60 | Ga0415639_000649 | 3300038395 | Bacteria | 29059 |
| 61 | Ga0415639_058897 | 3300038395 | Bacteria | 19315 |
| 62 | Ga0466657_331704 | 3300042582 | Bacteria | 1053 |
| 63 | Ga0466696_354527 | 3300042596 | Bacteria | 2726 |
| 64 | Ga0466729_260939 | 3300042621 | Bacteria | 4658 |
| 65 | Ga0466735_230668 | 3300042624 | Unclassified | 7101 |
| 66 | JGI24695J34938_10008338 | 3300002450 | Bacteria | 5924 |
| 67 | Ga0466700_037521 | 3300042600 | Bacteria | 3090 |
| 68 | Ga0466700_129335 | 3300042600 | Bacteria | 2165 |
| 69 | Ga0466714_013517 | 3300042603 | Bacteria | 3434 |
| 70 | Ga0466722_117272 | 3300042609 | Unclassified | 1363 |
| 71 | Ga0466710_368908 | 3300042613 | Bacteria | 2609 |
| 72 | Ga0466726_234102 | 3300042619 | Bacteria | 2694 |
| 73 | Ga0466728_267204 | 3300042620 | Bacteria | 3006 |
| 74 | Ga0466733_102397 | 3300042659 | Bacteria | 1131 |
| 75 | Ga0123357_10104137 | 3300009784 | Bacteria | 3646 |
| 76 | Ga0123356_10159016 | 3300010049 | Bacteria | 2254 |
| 77 | Ga0123356_10474439 | 3300010049 | Unclassified | 1403 |
| 78 | Ga0466735_058350 | 3300042624 | Bacteria | 2526 |
| 79 | Ga0466704_578311 | 3300042643 | Bacteria | 7216 |
| 80 | Ga0466727_342531 | 3300042655 | Unclassified | 3604 |
| 81 | Ga0466706_005305 | 3300042599 | Bacteria | 5949 |
| 82 | Ga0466717_138117 | 3300042604 | Bacteria | 1596 |
| 83 | Ga0466705_369970 | 3300042612 | Bacteria | 6418 |
| 84 | Ga0123357_10231117 | 3300009784 | Bacteria | 2027 |
| 85 | Ga0123357_10404785 | 3300009784 | Bacteria | 1237 |
| 86 | Ga0123355_10060187 | 3300009826 | Bacteria | 6133 |
| 87 | Ga0123353_10784634 | 3300010167 | Unclassified | 1319 |
| 88 | Ga0123354_10397006 | 3300010882 | Bacteria | 1172 |
| 89 | Ga0415639_011977 | 3300038395 | Unclassified | 7595 |
| 90 | Ga0415639_047140 | 3300038395 | Bacteria | 4557 |
| 91 | Ga0466692_109715 | 3300042591 | Bacteria | 6150 |
| 92 | Ga0466731_047507 | 3300042622 | Unclassified | 8035 |
| 93 | Ga0466731_219027 | 3300042622 | Bacteria | 3563 |
| 94 | Ga0466702_023810 | 3300042635 | Bacteria | 8662 |
| 95 | JGI24705J35276_12180271 | 3300002504 | Unclassified | 1362 |
| 96 | Ga0466700_305222 | 3300042600 | Bacteria | 12845 |
| 97 | Ga0466722_159916 | 3300042609 | Bacteria | 2121 |
| 98 | Ga0466728_060802 | 3300042620 | Bacteria | 30232 |
| 99 | Ga0123356_10335880 | 3300010049 | Unclassified | 1629 |
| 100 | Ga0415639_032684 | 3300038395 | Bacteria | 2283 |
| 101 | Ga0466693_241807 | 3300042592 | Unclassified | 3866 |
| 102 | Ga0466696_359839 | 3300042596 | Bacteria | 2991 |
| 103 | Ga0466704_465854 | 3300042643 | Bacteria | 1661 |
| 104 | Ga0466727_136147 | 3300042655 | Bacteria | 4656 |
| 105 | IMNBL1DRAFT_c0021039 | 3300000062 | Bacteria | 2622 |
| 106 | JGI24702J35022_10035657 | 3300002462 | Bacteria | 2661 |
| 107 | Ga0466714_119172 | 3300042603 | Bacteria | 4589 |
| 108 | Ga0466717_266755 | 3300042604 | Bacteria | 3108 |
| 109 | Ga0466721_207332 | 3300042608 | Bacteria | 1308 |
| 110 | Ga0466722_171565 | 3300042609 | Bacteria | 2398 |
| 111 | Ga0466722_225034 | 3300042609 | Unclassified | 12283 |
| 112 | Ga0466728_172076 | 3300042620 | Bacteria | 1889 |
| 113 | Ga0466729_016049 | 3300042621 | Bacteria | 1526 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042592 | Ga0466693_118594 | Ga0466693_118594_1976_2749 | 257 |
| 2 | 3300042610 | Ga0466698_046456 | Ga0466698_046456_12_785 | 257 |
| 3 | iso_pr_bacteria | 2820520043 | 2820522172 | 257 |
| 4 | 3300042601 | Ga0466707_216613 | Ga0466707_216613_1998_2864 | 259 |
| 5 | 3300042582 | Ga0466657_331704 | Ga0466657_331704_206_988 | 260 |
| 6 | 3300042601 | Ga0466707_026849 | Ga0466707_026849_28284_29147 | 260 |
| 7 | 3300042654 | Ga0466725_182797 | Ga0466725_182797_30_812 | 260 |
| 8 | 3300042609 | Ga0466722_225034 | Ga0466722_225034_8793_9578 | 261 |
| 9 | 3300009826 | Ga0123355_10363873 | Ga0123355_103638732 | 262 |
| 10 | 3300042609 | Ga0466722_117272 | Ga0466722_117272_22_810 | 262 |
| 11 | 3300042610 | Ga0466698_172300 | Ga0466698_172300_1434_2288 | 263 |
| 12 | 3300042622 | Ga0466731_047507 | Ga0466731_047507_3584_4441 | 266 |
| 13 | 3300010049 | Ga0123356_10101408 | Ga0123356_101014083 | 267 |
| 14 | 3300010167 | Ga0123353_10784634 | Ga0123353_107846342 | 267 |
| 15 | 3300010049 | Ga0123356_10171575 | Ga0123356_101715752 | 268 |
| 16 | 3300042604 | Ga0466717_138117 | Ga0466717_138117_652_1515 | 271 |
| 17 | 3300042596 | Ga0466696_354527 | Ga0466696_354527_84_947 | 272 |
| 18 | 3300042621 | Ga0466729_016049 | Ga0466729_016049_468_1331 | 280 |
| 19 | 3300042659 | Ga0466733_102397 | Ga0466733_102397_58_921 | 280 |
| 20 | 3300042613 | Ga0466710_368908 | Ga0466710_368908_1054_1917 | 281 |
| 21 | 3300042600 | Ga0466700_305222 | Ga0466700_305222_5910_6761 | 283 |
| 22 | 3300042603 | Ga0466714_027891 | Ga0466714_027891_29_883 | 284 |
| 23 | 3300042603 | Ga0466714_119172 | Ga0466714_119172_2284_3138 | 284 |
| 24 | 3300042610 | Ga0466698_170624 | Ga0466698_170624_518_1372 | 284 |
| 25 | 3300038395 | Ga0415639_047140 | Ga0415639_047140_827_1684 | 285 |
| 26 | 3300042592 | Ga0466693_241807 | Ga0466693_241807_1685_2542 | 285 |
| 27 | 3300042594 | Ga0466694_023995 | Ga0466694_023995_775_1632 | 285 |
| 28 | 3300042620 | Ga0466728_060802 | Ga0466728_060802_1069_1926 | 285 |
| 29 | 3300009826 | Ga0123355_10213002 | Ga0123355_102130023 | 286 |
| 30 | 3300009826 | Ga0123355_10257895 | Ga0123355_102578951 | 286 |
| 31 | 3300010049 | Ga0123356_10159016 | Ga0123356_101590164 | 286 |
| 32 | 3300038395 | Ga0415639_000649 | Ga0415639_000649_11274_12134 | 286 |
| 33 | 3300038395 | Ga0415639_011977 | Ga0415639_011977_4268_5128 | 286 |
| 34 | 3300038395 | Ga0415639_018690 | Ga0415639_018690_2458_3318 | 286 |
| 35 | 3300038395 | Ga0415639_032684 | Ga0415639_032684_859_1719 | 286 |
| 36 | 3300042593 | Ga0466691_193600 | Ga0466691_193600_569_1429 | 286 |
| 37 | 3300042600 | Ga0466700_037521 | Ga0466700_037521_89_949 | 286 |
| 38 | 3300042603 | Ga0466714_038277 | Ga0466714_038277_10973_11833 | 286 |
| 39 | 3300042603 | Ga0466714_094839 | Ga0466714_094839_91_951 | 286 |
| 40 | 3300042606 | Ga0466719_048831 | Ga0466719_048831_3027_3887 | 286 |
| 41 | 3300042609 | Ga0466722_159916 | Ga0466722_159916_461_1321 | 286 |
| 42 | 3300042612 | Ga0466705_450831 | Ga0466705_450831_623_1483 | 286 |
| 43 | 3300042620 | Ga0466728_102147 | Ga0466728_102147_673_1533 | 286 |
| 44 | 3300042624 | Ga0466735_058350 | Ga0466735_058350_402_1262 | 286 |
| 45 | 3300042636 | Ga0466703_424517 | Ga0466703_424517_136_996 | 286 |
| 46 | 3300042655 | Ga0466727_136147 | Ga0466727_136147_1411_2271 | 286 |
| 47 | 2225789004 | 2227101932 | 2227485803 | 287 |
| 48 | 3300002450 | JGI24695J34938_10008338 | JGI24695J34938_100083389 | 287 |
| 49 | 3300010049 | Ga0123356_10083274 | Ga0123356_100832743 | 287 |
| 50 | 3300010049 | Ga0123356_10474439 | Ga0123356_104744392 | 287 |
| 51 | 3300010167 | Ga0123353_10162388 | Ga0123353_101623883 | 287 |
| 52 | 3300010882 | Ga0123354_10293098 | Ga0123354_102930983 | 287 |
| 53 | 3300038395 | Ga0415639_047141 | Ga0415639_047141_9467_10330 | 287 |
| 54 | 3300038395 | Ga0415639_058897 | Ga0415639_058897_6628_7491 | 287 |
| 55 | 3300042592 | Ga0466693_000993 | Ga0466693_000993_1457_2320 | 287 |
| 56 | 3300042596 | Ga0466696_359839 | Ga0466696_359839_832_1695 | 287 |
| 57 | 3300042599 | Ga0466706_005305 | Ga0466706_005305_5059_5922 | 287 |
| 58 | 3300042600 | Ga0466700_129335 | Ga0466700_129335_474_1337 | 287 |
| 59 | 3300042600 | Ga0466700_353354 | Ga0466700_353354_227_1090 | 287 |
| 60 | 3300042601 | Ga0466707_422910 | Ga0466707_422910_156_1019 | 287 |
| 61 | 3300042603 | Ga0466714_013517 | Ga0466714_013517_956_1819 | 287 |
| 62 | 3300042603 | Ga0466714_046605 | Ga0466714_046605_351_1214 | 287 |
| 63 | 3300042603 | Ga0466714_138940 | Ga0466714_138940_67_930 | 287 |
| 64 | 3300042603 | Ga0466714_149303 | Ga0466714_149303_69_932 | 287 |
| 65 | 3300042604 | Ga0466717_266755 | Ga0466717_266755_98_961 | 287 |
| 66 | 3300042605 | Ga0466716_418756 | Ga0466716_418756_3963_4826 | 287 |
| 67 | 3300042608 | Ga0466721_207332 | Ga0466721_207332_381_1244 | 287 |
| 68 | 3300042609 | Ga0466722_129021 | Ga0466722_129021_5696_6559 | 287 |
| 69 | 3300042609 | Ga0466722_171565 | Ga0466722_171565_550_1413 | 287 |
| 70 | 3300042609 | Ga0466722_212160 | Ga0466722_212160_8088_8951 | 287 |
| 71 | 3300042611 | Ga0466697_159805 | Ga0466697_159805_446_1309 | 287 |
| 72 | 3300042612 | Ga0466705_369970 | Ga0466705_369970_4384_5247 | 287 |
| 73 | 3300042619 | Ga0466726_234102 | Ga0466726_234102_669_1532 | 287 |
| 74 | 3300042620 | Ga0466728_172076 | Ga0466728_172076_892_1755 | 287 |
| 75 | 3300042622 | Ga0466731_219027 | Ga0466731_219027_1339_2202 | 287 |
| 76 | 3300042624 | Ga0466735_230668 | Ga0466735_230668_1840_2703 | 287 |
| 77 | 3300042635 | Ga0466702_023810 | Ga0466702_023810_5554_6417 | 287 |
| 78 | 3300042643 | Ga0466704_195512 | Ga0466704_195512_249_1112 | 287 |
| 79 | 3300042654 | Ga0466725_202456 | Ga0466725_202456_221_1084 | 287 |
| 80 | 3300042655 | Ga0466727_342531 | Ga0466727_342531_330_1193 | 287 |
| 81 | 3300042659 | Ga0466733_180479 | Ga0466733_180479_641_1504 | 287 |
| 82 | iso_pr_bacteria | 2820501819 | 2820503816 | 287 |
| 83 | iso_pr_bacteria | 2820501819 | 2820504515 | 287 |
| 84 | iso_pr_bacteria | 2820551407 | 2820556351 | 287 |
| 85 | 3300002462 | JGI24702J35022_10035657 | JGI24702J35022_100356573 | 288 |
| 86 | 3300002504 | JGI24705J35276_12180271 | JGI24705J35276_121802711 | 288 |
| 87 | 3300009784 | Ga0123357_10055386 | Ga0123357_100553864 | 288 |
| 88 | 3300009784 | Ga0123357_10078039 | Ga0123357_100780393 | 288 |
| 89 | 3300009784 | Ga0123357_10104137 | Ga0123357_101041374 | 288 |
| 90 | 3300009784 | Ga0123357_10169632 | Ga0123357_101696321 | 288 |
| 91 | 3300009784 | Ga0123357_10231117 | Ga0123357_102311172 | 288 |
| 92 | 3300009784 | Ga0123357_10363624 | Ga0123357_103636241 | 288 |
| 93 | 3300009784 | Ga0123357_10404785 | Ga0123357_104047852 | 288 |
| 94 | 3300009784 | Ga0123357_10462134 | Ga0123357_104621341 | 288 |
| 95 | 3300009826 | Ga0123355_10060187 | Ga0123355_100601874 | 288 |
| 96 | 3300009826 | Ga0123355_10168945 | Ga0123355_101689453 | 288 |
| 97 | 3300009826 | Ga0123355_10239845 | Ga0123355_102398451 | 288 |
| 98 | 3300009826 | Ga0123355_10758187 | Ga0123355_107581872 | 288 |
| 99 | 3300010049 | Ga0123356_10039978 | Ga0123356_100399783 | 288 |
| 100 | 3300010049 | Ga0123356_10045854 | Ga0123356_100458544 | 288 |
| 101 | 3300010049 | Ga0123356_10068296 | Ga0123356_100682963 | 288 |
| 102 | 3300010049 | Ga0123356_10270998 | Ga0123356_102709983 | 288 |
| 103 | 3300010049 | Ga0123356_10335880 | Ga0123356_103358802 | 288 |
| 104 | 3300010167 | Ga0123353_10013207 | Ga0123353_100132073 | 288 |
| 105 | 3300010167 | Ga0123353_10610814 | Ga0123353_106108141 | 288 |
| 106 | 3300010882 | Ga0123354_10182718 | Ga0123354_101827183 | 288 |
| 107 | 3300010882 | Ga0123354_10397006 | Ga0123354_103970061 | 288 |
| 108 | 3300042591 | Ga0466692_109715 | Ga0466692_109715_2787_3653 | 288 |
| 109 | 3300042592 | Ga0466693_223500 | Ga0466693_223500_1679_2545 | 288 |
| 110 | 3300042620 | Ga0466728_267204 | Ga0466728_267204_2044_2910 | 288 |
| 111 | 3300042621 | Ga0466729_260939 | Ga0466729_260939_276_1142 | 288 |
| 112 | 3300005201 | Ga0072941_1057583 | Ga0072941_10575834 | 289 |
| 113 | 3300010882 | Ga0123354_10361792 | Ga0123354_103617922 | 289 |
| 114 | 3300000062 | IMNBL1DRAFT_c0021039 | IMNBL1DRAFT_00210393 | 290 |
| 115 | 3300042643 | Ga0466704_465854 | Ga0466704_465854_135_1160 | 320 |
| 116 | 3300042643 | Ga0466704_578311 | Ga0466704_578311_2459_3424 | 321 |
| 117 | 3300042612 | Ga0466705_239119 | Ga0466705_239119_4398_5447 | 328 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF19478 | TrbL_2 | TrbL/VirB6 plasmid conjugal transfer like protein | 31 | 171 | 0.95 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.51 | 0.56 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.