Protein Family IF05771
Metagenome
Isolate
159
Members
60
Samples
145
Scaffolds
432.21
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_017405|Ga0466707_017405_403_1701
- Length
- 432 aa
- Sequence
- MYRKAIKQLINWKLDKNKKPLIFLGARQVGKTWLIKEFGKNEYRQMAYINFDDKNAPKNMFLQNFDIKRIITELELYSGLKITPKDTLIVFDEIQSAPQGITSLKYFNENAPEYQIIAAGSLLGINIHPGESFPVGKVNYLQLYPMSFYEFLLAMGEENGLARILAEKLWEYLPSFAEKFKEFLRYYFYIGGMPEVVSVFAQDRDWKKARKIQDDILKNYQNDFSKHAPKEILPRINMVWENIPAQLAKENKKFIYGIIKEGARAKDFELAIQWLVDAGLLHKIYSVTKPALPLVAYQYLSAFKLYLGDVGLLAAMSKLNAKTLLNGDAVFTEFKGALAEQFVYQQLLLNENLSIHYFPFENSKYELDFLIQTEDDEIIPIEVKAGENLRAKSFKFFCEKYKPNKAIRTSLTDYKQESWFENVPLYLIGSYL
Sample Types
Isolate
8.8%
Metagenome
91.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.7%
Unclassified
25.0%
Kalotermitidae
16.7%
Termopsidae
5.0%
Passalidae
3.3%
Hodotermitidae
1.7%
Rhinotermitidae
1.7%
Taxonomy
Archaea
1
Bacteria
152
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 4 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 14 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 15 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 19 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 24 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 25 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 26 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 27 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 28 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 29 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 30 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 35 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 36 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 37 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 38 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 39 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 40 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 41 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 42 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 43 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 44 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 45 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 46 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 48 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 49 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 50 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 51 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 52 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 53 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 54 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 55 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 56 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 57 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 58 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 59 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 60 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466710_093842 | 3300042613 | Bacteria | 3583 |
| 2 | Ga0466715_273094 | 3300042616 | Bacteria | 3636 |
| 3 | Ga0123355_10000235 | 3300009826 | Bacteria | 70810 |
| 4 | Ga0123356_10174238 | 3300010049 | Bacteria | 2166 |
| 5 | Ga0123353_10127900 | 3300010167 | Bacteria | 4080 |
| 6 | Ga0123353_10234111 | 3300010167 | Unclassified | 2860 |
| 7 | Ga0123354_10176764 | 3300010882 | Bacteria | 2456 |
| 8 | Ga0466731_044447 | 3300042622 | Bacteria | 1886 |
| 9 | Ga0466731_091158 | 3300042622 | Bacteria | 4181 |
| 10 | Ga0466709_151099 | 3300042648 | Bacteria | 4067 |
| 11 | Ga0466701_059623 | 3300042598 | Bacteria | 2162 |
| 12 | Ga0466706_052254 | 3300042599 | Bacteria | 103343 |
| 13 | Ga0466706_229998 | 3300042599 | Bacteria | 7022 |
| 14 | Ga0466713_045334 | 3300042602 | Bacteria | 15956 |
| 15 | Ga0466716_417405 | 3300042605 | Archaea | 1880 |
| 16 | Ga0466719_018214 | 3300042606 | Bacteria | 1941 |
| 17 | Ga0466721_135818 | 3300042608 | Bacteria | 6340 |
| 18 | Ga0466693_397440 | 3300042592 | Bacteria | 1424 |
| 19 | Ga0466694_093738 | 3300042594 | Bacteria | 1449 |
| 20 | Ga0466694_173520 | 3300042594 | Bacteria | 3622 |
| 21 | Ga0466710_023282 | 3300042613 | Unclassified | 4030 |
| 22 | Ga0466711_318083 | 3300042615 | Bacteria | 4658 |
| 23 | Ga0466723_194220 | 3300042618 | Bacteria | 5980 |
| 24 | Ga0123356_10123432 | 3300010049 | Bacteria | 2524 |
| 25 | Ga0123353_10063634 | 3300010167 | Bacteria | 5916 |
| 26 | Ga0466700_254672 | 3300042600 | Bacteria | 254759 |
| 27 | Ga0466707_017405 | 3300042601 | Bacteria | 21356 |
| 28 | Ga0466713_021144 | 3300042602 | Bacteria | 13640 |
| 29 | Ga0466716_276038 | 3300042605 | Bacteria | 2635 |
| 30 | Ga0466698_286629 | 3300042610 | Bacteria | 3108 |
| 31 | Ga0466657_060241 | 3300042582 | Bacteria | 3624 |
| 32 | Ga0466699_249172 | 3300042597 | Bacteria | 1598 |
| 33 | 2227563493 | 2225789004 | Bacteria | 54164 |
| 34 | IMNBL1DRAFT_c0040487 | 3300000062 | Bacteria | 1576 |
| 35 | JGI24696J40584_12960477 | 3300002834 | Bacteria | 7362 |
| 36 | Ga0466697_148928 | 3300042611 | Bacteria | 1486 |
| 37 | Ga0466710_385217 | 3300042613 | Bacteria | 2111 |
| 38 | Ga0466710_435156 | 3300042613 | Bacteria | 1888 |
| 39 | Ga0466715_070176 | 3300042616 | Bacteria | 53352 |
| 40 | Ga0466715_318162 | 3300042616 | Bacteria | 1784 |
| 41 | Ga0123357_10003885 | 3300009784 | Bacteria | 17329 |
| 42 | Ga0123354_10085097 | 3300010882 | Bacteria | 4433 |
| 43 | Ga0466700_322058 | 3300042600 | Bacteria | 12846 |
| 44 | Ga0466707_397395 | 3300042601 | Bacteria | 2263 |
| 45 | Ga0466714_052802 | 3300042603 | Bacteria | 11571 |
| 46 | Ga0466719_275407 | 3300042606 | Bacteria | 2168 |
| 47 | Ga0415639_030414 | 3300038395 | Bacteria | 12975 |
| 48 | JGI24702J35022_10035715 | 3300002462 | Unclassified | 2658 |
| 49 | JGI24696J40584_12960428 | 3300002834 | Bacteria | 7193 |
| 50 | Ga0466712_052605 | 3300042614 | Bacteria | 1388 |
| 51 | Ga0466715_151713 | 3300042616 | Bacteria | 9966 |
| 52 | Ga0123356_10000643 | 3300010049 | Bacteria | 38403 |
| 53 | Ga0123356_10389251 | 3300010049 | Bacteria | 1529 |
| 54 | Ga0466734_173777 | 3300042623 | Bacteria | 1971 |
| 55 | Ga0466708_358292 | 3300042652 | Bacteria | 25849 |
| 56 | Ga0466708_361052 | 3300042652 | Bacteria | 8255 |
| 57 | Ga0466714_013023 | 3300042603 | Bacteria | 2511 |
| 58 | Ga0466717_159827 | 3300042604 | Bacteria | 1902 |
| 59 | Ga0466722_104649 | 3300042609 | Bacteria | 7087 |
| 60 | Ga0466722_229738 | 3300042609 | Bacteria | 42096 |
| 61 | Ga0466657_274305 | 3300042582 | Bacteria | 3351 |
| 62 | IMNBL1DRAFT_c0000378 | 3300000062 | Bacteria | 38118 |
| 63 | JGI24702J35022_10005536 | 3300002462 | Bacteria | 7365 |
| 64 | JGI24702J35022_10020649 | 3300002462 | Bacteria | 3574 |
| 65 | JGI24702J35022_10031354 | 3300002462 | Bacteria | 2849 |
| 66 | Ga0466697_186890 | 3300042611 | Bacteria | 2609 |
| 67 | Ga0466705_270455 | 3300042612 | Bacteria | 3854 |
| 68 | Ga0466733_113728 | 3300042659 | Bacteria | 3424 |
| 69 | Ga0466710_055955 | 3300042613 | Bacteria | 11348 |
| 70 | Ga0123357_10156088 | 3300009784 | Bacteria | 2752 |
| 71 | Ga0123356_10000234 | 3300010049 | Bacteria | 64081 |
| 72 | Ga0123353_10001992 | 3300010167 | Bacteria | 25232 |
| 73 | Ga0466731_423609 | 3300042622 | Bacteria | 6003 |
| 74 | Ga0466701_021476 | 3300042598 | Bacteria | 1724 |
| 75 | Ga0466707_043718 | 3300042601 | Bacteria | 9822 |
| 76 | Ga0466695_032185 | 3300042595 | Bacteria | 1537 |
| 77 | 2227485751 | 2225789004 | Bacteria | 21283 |
| 78 | JGI24702J35022_10044075 | 3300002462 | Bacteria | 2377 |
| 79 | JGI24702J35022_10108625 | 3300002462 | Bacteria | 1524 |
| 80 | Ga0123357_10000530 | 3300009784 | Bacteria | 37490 |
| 81 | Ga0466726_166280 | 3300042619 | Bacteria | 2385 |
| 82 | Ga0123357_10044974 | 3300009784 | Bacteria | 5992 |
| 83 | Ga0466731_057286 | 3300042622 | Bacteria | 25929 |
| 84 | Ga0466735_166359 | 3300042624 | Bacteria | 1647 |
| 85 | Ga0466703_122199 | 3300042636 | Bacteria | 2544 |
| 86 | Ga0466709_033285 | 3300042648 | Bacteria | 1872 |
| 87 | Ga0466708_466392 | 3300042652 | Bacteria | 1632 |
| 88 | Ga0466727_125117 | 3300042655 | Bacteria | 15260 |
| 89 | Ga0466701_023633 | 3300042598 | Bacteria | 21206 |
| 90 | Ga0466707_203571 | 3300042601 | Bacteria | 51511 |
| 91 | Ga0466714_111209 | 3300042603 | Bacteria | 1913 |
| 92 | Ga0466717_031517 | 3300042604 | Bacteria | 3344 |
| 93 | Ga0466717_219464 | 3300042604 | Bacteria | 1773 |
| 94 | Ga0466698_335354 | 3300042610 | Bacteria | 1542 |
| 95 | Ga0466693_443883 | 3300042592 | Bacteria | 1893 |
| 96 | Ga0466694_123844 | 3300042594 | Bacteria | 4140 |
| 97 | 2227089154 | 2225789004 | Bacteria | 9879 |
| 98 | JGI24702J35022_10067196 | 3300002462 | Bacteria | 1925 |
| 99 | Ga0466697_190179 | 3300042611 | Bacteria | 1998 |
| 100 | Ga0466697_242644 | 3300042611 | Bacteria | 1788 |
| 101 | Ga0466705_207290 | 3300042612 | Bacteria | 3078 |
| 102 | Ga0466733_110948 | 3300042659 | Bacteria | 5948 |
| 103 | Ga0466715_095350 | 3300042616 | Bacteria | 10005 |
| 104 | Ga0123357_10012311 | 3300009784 | Bacteria | 11025 |
| 105 | Ga0123353_10154292 | 3300010167 | Bacteria | 3663 |
| 106 | Ga0123353_10266820 | 3300010167 | Bacteria | 2640 |
| 107 | Ga0123353_10342685 | 3300010167 | Bacteria | 2257 |
| 108 | Ga0466731_218895 | 3300042622 | Bacteria | 1921 |
| 109 | Ga0466703_288990 | 3300042636 | Bacteria | 14417 |
| 110 | Ga0466708_327323 | 3300042652 | Bacteria | 5655 |
| 111 | Ga0466708_355809 | 3300042652 | Bacteria | 1687 |
| 112 | Ga0466700_170929 | 3300042600 | Bacteria | 13271 |
| 113 | Ga0466714_165118 | 3300042603 | Bacteria | 3264 |
| 114 | Ga0466719_099492 | 3300042606 | Bacteria | 22617 |
| 115 | Ga0466719_171633 | 3300042606 | Bacteria | 1992 |
| 116 | Ga0466722_097374 | 3300042609 | Bacteria | 2597 |
| 117 | Ga0466693_250910 | 3300042592 | Bacteria | 1720 |
| 118 | Ga0466693_379176 | 3300042592 | Bacteria | 1684 |
| 119 | Ga0466695_296241 | 3300042595 | Bacteria | 2222 |
| 120 | 2227624070 | 2225789004 | Bacteria | 2168 |
| 121 | JGI24695J34938_10003676 | 3300002450 | Bacteria | 10504 |
| 122 | JGI24702J35022_10008278 | 3300002462 | Unclassified | 5892 |
| 123 | Ga0123357_10000567 | 3300009784 | Bacteria | 36488 |
| 124 | Ga0466697_235363 | 3300042611 | Bacteria | 3187 |
| 125 | Ga0466733_163995 | 3300042659 | Bacteria | 1566 |
| 126 | Ga0466711_091757 | 3300042615 | Bacteria | 11740 |
| 127 | Ga0123357_10091293 | 3300009784 | Bacteria | 3967 |
| 128 | Ga0123357_10144231 | 3300009784 | Bacteria | 2915 |
| 129 | Ga0123357_10244192 | 3300009784 | Bacteria | 1937 |
| 130 | Ga0123356_10010064 | 3300010049 | Bacteria | 9299 |
| 131 | Ga0123356_10046603 | 3300010049 | Bacteria | 4034 |
| 132 | Ga0123356_10215008 | 3300010049 | Bacteria | 1974 |
| 133 | Ga0123353_10000175 | 3300010167 | Bacteria | 81609 |
| 134 | Ga0123353_10228040 | 3300010167 | Unclassified | 2906 |
| 135 | Ga0123353_10536914 | 3300010167 | Unclassified | 1691 |
| 136 | Ga0123354_10012147 | 3300010882 | Bacteria | 13338 |
| 137 | Ga0466735_120505 | 3300042624 | Bacteria | 9667 |
| 138 | Ga0466724_32484 | 3300042649 | Bacteria | 4908 |
| 139 | Ga0466725_043009 | 3300042654 | Bacteria | 4236 |
| 140 | Ga0466727_116418 | 3300042655 | Bacteria | 2731 |
| 141 | Ga0466727_152394 | 3300042655 | Bacteria | 1894 |
| 142 | Ga0466717_065132 | 3300042604 | Bacteria | 4299 |
| 143 | Ga0466690_101951 | 3300042590 | Bacteria | 4966 |
| 144 | Ga0466694_144355 | 3300042594 | Bacteria | 2172 |
| 145 | IMNBL1DRAFT_c0027857 | 3300000062 | Bacteria | 2118 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.