Protein Family IF05747
Metagenome
Isolate
173
Members
60
Samples
164
Scaffolds
577.17
Avg Length
Representative Sequence
- ID
- 3300042600|Ga0466700_355727|Ga0466700_355727_61_1926
- Length
- 621 aa
- Sequence
- LPYTESQDIFHSTGKKDLTHKLKTFLIHLIFVLLKHSFVKNTKMDNNQIFSDVKKKAATWLSDAFDENTRTQVQNMMDSHPDELTECFYRNLEFGTGGLRGLMGAGTNRMNIYTVGMATQGLCNYLKRNFASLPQIKVAIAHDSRNNSRLFAETTAGIFAANGIRVYLFDALRPTPELSFTIRHFGCQSGVVITASHNPKEYNGYKAYWDDGGQVISPHDKGIIEEVNRTTIESVKFNGPKELITVIGKEIDEIYTDAIVGLSLSPEAIARHSDLKIVYTPIHGTGVELVPMTLKKKGFTNIYHIPEQNVPDGNFPTVKSPNPEESAALNLAMQKAKEVDADIVMGTDPDADRVGIAVKNGTGEWVILNGNQAAAVLIYYLLKRWDELGKLKGSEYIVKTIVTSELLAEIATDCQVPYFDVLTGFKWIADVIRRNEGAKTFIGGGEESYGYLCGEFVRDKDAVMSCAFFAEIAAWAKDQGKTMFDILIDIYVNYNFYKETGVSVVKTGKSGAEEIKAMMETYRKTPLKTLGGSPVVKLLDYEMQIAADLTTGKTEKIDLPKSDVLQFLTADGTKVSIRPSGTEPKIKYYISVKEPLPSVADYARVNEALDARIEDIVNELK
Sample Types
Isolate
5.2%
Metagenome
94.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.0%
Kalotermitidae
23.3%
Unclassified
15.0%
Formicidae
5.0%
Rhinotermitidae
5.0%
Termopsidae
5.0%
Passalidae
3.3%
Blattidae
3.3%
Culicidae
1.7%
Hodotermitidae
1.7%
Nephropidae
1.7%
Taxonomy
Archaea
0
Bacteria
169
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 14 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 15 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 16 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 17 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 18 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 19 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 24 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 27 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 28 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 29 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 30 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 35 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 36 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 39 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 45 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 46 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 47 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 48 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 49 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 50 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 51 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 52 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 53 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 54 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 55 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 56 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 57 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 58 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 59 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 60 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_061622 | 3300042659 | Bacteria | 45413 |
| 2 | Ga0466707_188845 | 3300042601 | Bacteria | 16270 |
| 3 | Ga0466717_083412 | 3300042604 | Bacteria | 6099 |
| 4 | Ga0466719_183714 | 3300042606 | Bacteria | 4722 |
| 5 | Ga0466722_111476 | 3300042609 | Bacteria | 56871 |
| 6 | Ga0456237_0000003 | 3300041968 | Bacteria | 82299 |
| 7 | Ga0466690_043583 | 3300042590 | Bacteria | 17399 |
| 8 | Ga0466690_260668 | 3300042590 | Bacteria | 3671 |
| 9 | Ga0466690_400825 | 3300042590 | Bacteria | 16559 |
| 10 | Ga0466696_268297 | 3300042596 | Bacteria | 13144 |
| 11 | JGI24702J35022_10000981 | 3300002462 | Bacteria | 17869 |
| 12 | Ga0103263_100715 | 3300007042 | Bacteria | 4531 |
| 13 | Ga0123357_10000677 | 3300009784 | Bacteria | 34044 |
| 14 | Ga0466711_001323 | 3300042615 | Bacteria | 18790 |
| 15 | Ga0466711_136051 | 3300042615 | Bacteria | 2788 |
| 16 | Ga0466711_502333 | 3300042615 | Bacteria | 6123 |
| 17 | Ga0466723_290087 | 3300042618 | Bacteria | 15581 |
| 18 | Ga0123356_10059673 | 3300010049 | Bacteria | 3559 |
| 19 | Ga0123353_10006245 | 3300010167 | Bacteria | 15841 |
| 20 | Ga0466733_056566 | 3300042659 | Bacteria | 66737 |
| 21 | Ga0466733_105048 | 3300042659 | Bacteria | 8040 |
| 22 | Ga0466706_036961 | 3300042599 | Bacteria | 15127 |
| 23 | Ga0466706_060848 | 3300042599 | Bacteria | 6158 |
| 24 | Ga0466714_093285 | 3300042603 | Bacteria | 105352 |
| 25 | Ga0466716_397325 | 3300042605 | Bacteria | 4491 |
| 26 | Ga0466657_250983 | 3300042582 | Bacteria | 7232 |
| 27 | Ga0466690_153082 | 3300042590 | Bacteria | 5189 |
| 28 | Ga0466690_295206 | 3300042590 | Bacteria | 14105 |
| 29 | Ga0466693_178590 | 3300042592 | Bacteria | 5368 |
| 30 | Ga0466691_173679 | 3300042593 | Bacteria | 10823 |
| 31 | Ga0068305_10000300 | 3300005083 | Bacteria | 21290 |
| 32 | Ga0466715_064402 | 3300042616 | Bacteria | 36083 |
| 33 | Ga0466715_402756 | 3300042616 | Bacteria | 7590 |
| 34 | Ga0466723_014070 | 3300042618 | Bacteria | 20985 |
| 35 | Ga0466723_053207 | 3300042618 | Bacteria | 23381 |
| 36 | Ga0466723_064404 | 3300042618 | Bacteria | 11296 |
| 37 | Ga0466723_164021 | 3300042618 | Bacteria | 38027 |
| 38 | Ga0123354_10034860 | 3300010882 | Bacteria | 7865 |
| 39 | Ga0466709_016315 | 3300042648 | Bacteria | 10373 |
| 40 | Ga0466724_00883 | 3300042649 | Bacteria | 15481 |
| 41 | Ga0466708_041066 | 3300042652 | Bacteria | 12959 |
| 42 | Ga0466708_110426 | 3300042652 | Bacteria | 6520 |
| 43 | Ga0466727_294835 | 3300042655 | Bacteria | 4715 |
| 44 | Ga0466700_403019 | 3300042600 | Bacteria | 2790 |
| 45 | Ga0466713_041659 | 3300042602 | Bacteria | 15881 |
| 46 | Ga0466717_018136 | 3300042604 | Bacteria | 2630 |
| 47 | Ga0466716_288764 | 3300042605 | Bacteria | 43815 |
| 48 | Ga0466722_182057 | 3300042609 | Bacteria | 3545 |
| 49 | Ga0160472_100025 | 3300012839 | Bacteria | 320056 |
| 50 | Ga0466691_185768 | 3300042593 | Bacteria | 8529 |
| 51 | Ga0466696_156913 | 3300042596 | Bacteria | 7767 |
| 52 | Ga0466711_099584 | 3300042615 | Bacteria | 34400 |
| 53 | Ga0466715_128475 | 3300042616 | Bacteria | 2425 |
| 54 | Ga0466715_160060 | 3300042616 | Bacteria | 3182 |
| 55 | Ga0466715_221281 | 3300042616 | Bacteria | 18002 |
| 56 | Ga0466715_554015 | 3300042616 | Bacteria | 5583 |
| 57 | Ga0466723_019379 | 3300042618 | Bacteria | 15330 |
| 58 | Ga0123353_10028875 | 3300010167 | Bacteria | 8534 |
| 59 | Ga0123353_10276362 | 3300010167 | Bacteria | 2583 |
| 60 | Ga0466703_252887 | 3300042636 | Bacteria | 12128 |
| 61 | Ga0466703_402500 | 3300042636 | Bacteria | 4186 |
| 62 | Ga0466704_030571 | 3300042643 | Bacteria | 29418 |
| 63 | Ga0466709_139708 | 3300042648 | Bacteria | 1934 |
| 64 | Ga0466708_052136 | 3300042652 | Bacteria | 19216 |
| 65 | Ga0466727_032046 | 3300042655 | Bacteria | 9291 |
| 66 | Ga0466705_142390 | 3300042612 | Bacteria | 11920 |
| 67 | Ga0466733_025323 | 3300042659 | Bacteria | 2763 |
| 68 | Ga0466701_065689 | 3300042598 | Bacteria | 3953 |
| 69 | Ga0466707_034938 | 3300042601 | Bacteria | 23566 |
| 70 | Ga0466707_231570 | 3300042601 | Bacteria | 22207 |
| 71 | Ga0466690_299089 | 3300042590 | Bacteria | 33566 |
| 72 | Ga0068305_10025582 | 3300005083 | Bacteria | 10039 |
| 73 | Ga0466715_125679 | 3300042616 | Bacteria | 15585 |
| 74 | Ga0466715_376733 | 3300042616 | Bacteria | 17373 |
| 75 | Ga0466723_294656 | 3300042618 | Bacteria | 18347 |
| 76 | Ga0466723_323721 | 3300042618 | Bacteria | 25497 |
| 77 | Ga0466728_291780 | 3300042620 | Bacteria | 2308 |
| 78 | Ga0123353_10015042 | 3300010167 | Bacteria | 11205 |
| 79 | Ga0123354_10061188 | 3300010882 | Bacteria | 5559 |
| 80 | Ga0466703_160339 | 3300042636 | Bacteria | 9123 |
| 81 | Ga0466704_227670 | 3300042643 | Bacteria | 14516 |
| 82 | Ga0466704_403719 | 3300042643 | Bacteria | 10396 |
| 83 | Ga0466725_187504 | 3300042654 | Bacteria | 31004 |
| 84 | Ga0466705_069154 | 3300042612 | Bacteria | 4656 |
| 85 | Ga0466733_094453 | 3300042659 | Bacteria | 2831 |
| 86 | Ga0466706_131766 | 3300042599 | Bacteria | 12916 |
| 87 | Ga0466713_110523 | 3300042602 | Bacteria | 3368 |
| 88 | Ga0466722_031691 | 3300042609 | Bacteria | 2509 |
| 89 | Ga0466722_075216 | 3300042609 | Bacteria | 4749 |
| 90 | Ga0466692_183364 | 3300042591 | Bacteria | 4519 |
| 91 | Ga0466695_246679 | 3300042595 | Bacteria | 2505 |
| 92 | Ga0466696_104752 | 3300042596 | Bacteria | 4437 |
| 93 | Ga0466696_399392 | 3300042596 | Bacteria | 3393 |
| 94 | 2227280804 | 2225789004 | Unclassified | 6811 |
| 95 | CVPL010W_10001073 | 3300002931 | Bacteria | 44186 |
| 96 | Ga0466711_430183 | 3300042615 | Bacteria | 17883 |
| 97 | Ga0123356_10125292 | 3300010049 | Bacteria | 2506 |
| 98 | Ga0466734_104460 | 3300042623 | Bacteria | 3583 |
| 99 | Ga0466703_286348 | 3300042636 | Bacteria | 7433 |
| 100 | Ga0466704_559893 | 3300042643 | Bacteria | 21909 |
| 101 | Ga0466709_410572 | 3300042648 | Bacteria | 35233 |
| 102 | Ga0466727_351902 | 3300042655 | Bacteria | 5100 |
| 103 | Ga0466706_007074 | 3300042599 | Bacteria | 64572 |
| 104 | Ga0466700_355727 | 3300042600 | Bacteria | 2077 |
| 105 | Ga0466713_024240 | 3300042602 | Bacteria | 50826 |
| 106 | Ga0466713_095475 | 3300042602 | Bacteria | 20507 |
| 107 | Ga0466714_025158 | 3300042603 | Bacteria | 61228 |
| 108 | Ga0466716_287438 | 3300042605 | Bacteria | 18951 |
| 109 | Ga0466719_208696 | 3300042606 | Bacteria | 21658 |
| 110 | Ga0466719_444908 | 3300042606 | Bacteria | 6268 |
| 111 | Ga0466691_031323 | 3300042593 | Unclassified | 6026 |
| 112 | Ga0466695_239997 | 3300042595 | Bacteria | 2353 |
| 113 | IMNBL1DRAFT_c0009973 | 3300000062 | Bacteria | 4610 |
| 114 | IMNBL1DRAFT_c0013541 | 3300000062 | Bacteria | 3651 |
| 115 | JGI24702J35022_10013273 | 3300002462 | Bacteria | 4564 |
| 116 | Ga0068302_10049242 | 3300005071 | Bacteria | 4274 |
| 117 | Ga0466715_079603 | 3300042616 | Bacteria | 222305 |
| 118 | Ga0466715_179288 | 3300042616 | Bacteria | 26870 |
| 119 | Ga0466715_402871 | 3300042616 | Bacteria | 5487 |
| 120 | Ga0466728_464616 | 3300042620 | Bacteria | 1801 |
| 121 | Ga0123354_10002184 | 3300010882 | Bacteria | 25403 |
| 122 | Ga0466705_198636 | 3300042612 | Bacteria | 3770 |
| 123 | Ga0466732_161338 | 3300042656 | Bacteria | 2654 |
| 124 | Ga0466707_288988 | 3300042601 | Bacteria | 3836 |
| 125 | Ga0466713_112630 | 3300042602 | Bacteria | 50784 |
| 126 | Ga0466714_124101 | 3300042603 | Bacteria | 30720 |
| 127 | Ga0466719_498714 | 3300042606 | Bacteria | 2510 |
| 128 | Ga0466698_392930 | 3300042610 | Bacteria | 2059 |
| 129 | Ga0466690_044861 | 3300042590 | Bacteria | 3336 |
| 130 | Ga0466690_108802 | 3300042590 | Bacteria | 9746 |
| 131 | Ga0466696_001652 | 3300042596 | Bacteria | 32781 |
| 132 | Ga0466696_467056 | 3300042596 | Bacteria | 1898 |
| 133 | IMNBL1DRAFT_c0001430 | 3300000062 | Bacteria | 17865 |
| 134 | IMNBL1DRAFT_c0015056 | 3300000062 | Bacteria | 3373 |
| 135 | JGI24695J34938_10003522 | 3300002450 | Bacteria | 10862 |
| 136 | JGI24702J35022_10000464 | 3300002462 | Bacteria | 24409 |
| 137 | Ga0102740_1001256 | 3300007140 | Bacteria | 6565 |
| 138 | Ga0466715_205744 | 3300042616 | Bacteria | 41900 |
| 139 | Ga0466723_095909 | 3300042618 | Unclassified | 7807 |
| 140 | Ga0466735_086464 | 3300042624 | Bacteria | 5544 |
| 141 | Ga0466735_190007 | 3300042624 | Bacteria | 3006 |
| 142 | Ga0466703_260613 | 3300042636 | Bacteria | 18120 |
| 143 | Ga0466709_346172 | 3300042648 | Bacteria | 19067 |
| 144 | Ga0466708_172128 | 3300042652 | Bacteria | 12283 |
| 145 | Ga0466708_379152 | 3300042652 | Bacteria | 6693 |
| 146 | Ga0466725_461920 | 3300042654 | Bacteria | 38511 |
| 147 | Ga0466697_168887 | 3300042611 | Bacteria | 9525 |
| 148 | Ga0466705_211173 | 3300042612 | Bacteria | 7116 |
| 149 | Ga0466706_028017 | 3300042599 | Bacteria | 30169 |
| 150 | Ga0466706_289888 | 3300042599 | Bacteria | 10166 |
| 151 | Ga0466713_105925 | 3300042602 | Bacteria | 5280 |
| 152 | Ga0466716_063803 | 3300042605 | Bacteria | 2345 |
| 153 | Ga0466690_269808 | 3300042590 | Unclassified | 4456 |
| 154 | Ga0466691_071250 | 3300042593 | Bacteria | 14524 |
| 155 | Ga0466691_129914 | 3300042593 | Bacteria | 2574 |
| 156 | JGI24702J35022_10005345 | 3300002462 | Bacteria | 7524 |
| 157 | JGI24696J40584_12956634 | 3300002834 | Bacteria | 3176 |
| 158 | Ga0466711_042033 | 3300042615 | Bacteria | 11823 |
| 159 | Ga0466711_104172 | 3300042615 | Bacteria | 17590 |
| 160 | Ga0466728_341550 | 3300042620 | Bacteria | 38650 |
| 161 | Ga0466728_368254 | 3300042620 | Bacteria | 2620 |
| 162 | Ga0466735_194555 | 3300042624 | Bacteria | 4893 |
| 163 | Ga0466708_224582 | 3300042652 | Bacteria | 11662 |
| 164 | Ga0466727_015058 | 3300042655 | Bacteria | 77303 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02878 | PGM_PMM_I | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I | 93 | 230 | 0.97 |
| PF02880 | PGM_PMM_III | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III | 369 | 491 | 0.93 |
| PF02879 | PGM_PMM_II | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II | 255 | 361 | 0.91 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02879 | GO:0005975 | carbohydrate metabolic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.