Protein Family IF05733

Metagenome Isolate
272 Members
94 Samples
224 Scaffolds
393.67 Avg Length

🧬 Representative Sequence

ID
3300042600|Ga0466700_250129|Ga0466700_250129_167_1507
Length
446 aa
Sequence
MQKIKMTTPLVEMDGDEMTRILWQMIKDELLLPYIDLKTEYYDLGLKYRNETNDQVTFDSAEATIKYGVAVKCATITPNAARMSEYNLKKLWKSPNVTIRAILDGTVFRAPIVVNGIDPMVKCWQGPITIARHAYGDVYKNTEFIIAGAGKAELVFTAADGTVIRETIHDFDGPGILQSIHNTEKSIRSFAKACFNYALDTRQDLWFATKDTISQKYDHTFKDIVQEIFEKEYRERFAAAGIAYFYTLIDDAVARVMRDKGGFIWACKNYDGDVMSDMVSSAFGSLAMMTSVLVSPAGAYEYEAAHGTVQRHYYQHLEGKETSTNSVATIFAWTGALRKRGELDGLTGLVNFADALEKSTLATIESGKMTKDLALITTIKNAEILNSHDFIKAIHIPTNRRAGAMAAKQTYPRRPNKLLPIPHKKRITDIQAFHIHWRGASILPRC

πŸ“Š Sample Types

Isolate 17.6%
Metagenome 82.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 36.2%
Termitidae 26.6%
Blattidae 14.9%
Kalotermitidae 13.8%
Termopsidae 3.2%
Rhinotermitidae 2.1%
Passalidae 2.1%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 263
Eukaryota 0
Viruses 0
Unclassified 9

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
2 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
3 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
4 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
5 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
6 2820339298 Unclassified Firmicutes Nt197P3bin68 Isolate Unclassified
7 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
8 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
14 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
15 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 2820833147 Unclassified Actinobacteria Lab288P4bin85 Isolate Unclassified
18 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
19 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
20 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
21 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
22 2820364642 Unclassified Firmicutes Nt197P3bin107 Isolate Unclassified
23 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
24 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
25 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
26 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
27 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
28 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
29 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
30 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
31 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
32 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
33 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
34 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
35 2820569216 Unclassified Firmicutes Emb289P3bin33 Isolate Unclassified
36 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
37 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
38 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
39 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
40 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
41 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
42 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
43 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
44 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
45 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
46 2820463629 Unclassified Firmicutes Lab288P3bin124 Isolate Unclassified
47 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
48 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
49 2593339125 Clostridium sp. 5 Isolate Termitidae
50 2819998259 Unclassified Spirochaetes Nc150P4bin23 Isolate Unclassified
51 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
52 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
53 2820800812 Unclassified Actinobacteria Th196P4bin28 Isolate Unclassified
54 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
55 2820014844 Unclassified Spirochaetes Nt197P3bin95 Isolate Unclassified
56 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
57 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
58 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
59 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
60 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
61 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
62 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
63 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
64 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
65 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
66 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
67 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
68 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
69 2820319488 Unclassified Firmicutes Nt197P3bin88 Isolate Unclassified
70 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
71 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
72 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
73 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
74 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
75 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
76 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
77 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
78 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
79 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
80 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
81 2590828840 Clostridium sp. 2 Isolate Termitidae
82 2820350530 Unclassified Firmicutes Nt197P3bin37 Isolate Unclassified
83 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
84 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
85 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
86 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
87 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
88 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
89 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
90 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
91 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
92 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
93 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
94 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_097028 3300042612 Bacteria 11533
2 Ga0466704_168208 3300042643 Bacteria 28884
3 Ga0466708_049527 3300042652 Bacteria 11405
4 Ga0466706_009181 3300042599 Unclassified 10337
5 Ga0466706_188526 3300042599 Bacteria 15141
6 Ga0466706_238327 3300042599 Bacteria 15685
7 Ga0466700_100190 3300042600 Bacteria 2839
8 Ga0466707_319311 3300042601 Bacteria 64740
9 Ga0466707_335813 3300042601 Bacteria 33089
10 Ga0466713_038750 3300042602 Bacteria 43043
11 Ga0466713_114126 3300042602 Unclassified 3560
12 Ga0466717_043776 3300042604 Bacteria 4058
13 Ga0466690_304202 3300042590 Bacteria 3108
14 Ga0466696_429347 3300042596 Bacteria 12076
15 Ga0123355_10113151 3300009826 Bacteria 4234
16 Ga0123356_10000025 3300010049 Bacteria 166353
17 Ga0123356_10022953 3300010049 Bacteria 5882
18 Ga0123356_10023676 3300010049 Bacteria 5777
19 Ga0123353_10042172 3300010167 Bacteria 7215
20 Ga0123353_10316872 3300010167 Bacteria 2369
21 Ga0123353_10353926 3300010167 Bacteria 2211
22 Ga0123353_10389067 3300010167 Bacteria 2081
23 Ga0123354_10219225 3300010882 Bacteria 2027
24 JGI24705J35276_12225080 3300002504 Bacteria 2679
25 Ga0068302_10013988 3300005071 Bacteria 12980
26 Ga0466711_017116 3300042615 Bacteria 84050
27 Ga0466711_401690 3300042615 Bacteria 1551
28 Ga0466705_046448 3300042612 Bacteria 12793
29 Ga0466708_313266 3300042652 Bacteria 17281
30 Ga0466706_003003 3300042599 Bacteria 3349
31 Ga0466706_089758 3300042599 Bacteria 7917
32 Ga0466706_125295 3300042599 Bacteria 3607
33 Ga0466706_267194 3300042599 Bacteria 8347
34 Ga0466700_250129 3300042600 Bacteria 3436
35 Ga0466707_242321 3300042601 Bacteria 2064
36 Ga0466713_105987 3300042602 Bacteria 56927
37 Ga0466713_114798 3300042602 Bacteria 2439
38 Ga0466719_008873 3300042606 Bacteria 7561
39 Ga0466721_391751 3300042608 Bacteria 12745
40 Ga0466722_088366 3300042609 Bacteria 8524
41 Ga0466722_156272 3300042609 Bacteria 6775
42 Ga0415639_002797 3300038395 Bacteria 11795
43 Ga0466696_284476 3300042596 Bacteria 30745
44 Ga0123356_10008044 3300010049 Bacteria 10494
45 Ga0123356_10547306 3300010049 Bacteria 1318
46 Ga0123353_10233980 3300010167 Bacteria 2861
47 Ga0123353_10372346 3300010167 Bacteria 2141
48 AustNasuHG_c1005454 3300000089 Bacteria 4546
49 Ga0068305_10001878 3300005083 Bacteria 41327
50 Ga0466723_128410 3300042618 Bacteria 3916
51 Ga0466723_141786 3300042618 Bacteria 23960
52 Ga0466726_373558 3300042619 Bacteria 5403
53 Ga0466705_117048 3300042612 Bacteria 3869
54 Ga0466705_375992 3300042612 Bacteria 6956
55 Ga0466733_065374 3300042659 Bacteria 13383
56 Ga0466733_144102 3300042659 Bacteria 37735
57 Ga0466702_328262 3300042635 Bacteria 3571
58 Ga0466704_401042 3300042643 Bacteria 6095
59 Ga0466704_619471 3300042643 Bacteria 40828
60 Ga0466706_016230 3300042599 Bacteria 7447
61 Ga0466706_250408 3300042599 Bacteria 38512
62 Ga0466706_263200 3300042599 Bacteria 5961
63 Ga0466706_276776 3300042599 Bacteria 31951
64 Ga0466707_079678 3300042601 Bacteria 35130
65 Ga0466707_312796 3300042601 Unclassified 5964
66 Ga0466716_105965 3300042605 Bacteria 4526
67 Ga0466719_154243 3300042606 Bacteria 12224
68 Ga0466721_326403 3300042608 Bacteria 2509
69 Ga0415639_001252 3300038395 Bacteria 16025
70 Ga0415639_006490 3300038395 Bacteria 35011
71 Ga0466693_002468 3300042592 Bacteria 1799
72 Ga0466691_049117 3300042593 Bacteria 4062
73 Ga0466691_186074 3300042593 Bacteria 17073
74 Ga0123356_10000267 3300010049 Bacteria 60216
75 Ga0123353_10007382 3300010167 Bacteria 14845
76 Ga0123353_10015935 3300010167 Bacteria 10958
77 Ga0123353_10030013 3300010167 Bacteria 8391
78 Ga0123353_10423322 3300010167 Bacteria 1972
79 Ga0123353_10586427 3300010167 Bacteria 1598
80 Ga0123354_10088765 3300010882 Bacteria 4297
81 Ga0466711_054678 3300042615 Bacteria 13647
82 Ga0466715_596696 3300042616 Bacteria 9450
83 Ga0466726_221260 3300042619 Bacteria 1690
84 Ga0466729_144867 3300042621 Bacteria 2442
85 Ga0466705_043866 3300042612 Bacteria 2781
86 Ga0466733_067446 3300042659 Bacteria 2409
87 Ga0466702_277512 3300042635 Bacteria 2013
88 Ga0466703_171715 3300042636 Bacteria 7365
89 Ga0466727_167370 3300042655 Bacteria 11748
90 Ga0466706_130678 3300042599 Bacteria 70477
91 Ga0466706_243559 3300042599 Bacteria 3067
92 Ga0466706_247257 3300042599 Bacteria 4027
93 Ga0466707_128989 3300042601 Bacteria 3401
94 Ga0466714_079484 3300042603 Bacteria 2021
95 Ga0466716_123880 3300042605 Bacteria 6381
96 Ga0415639_010082 3300038395 Bacteria 3418
97 Ga0415639_052974 3300038395 Bacteria 14184
98 Ga0466696_022689 3300042596 Bacteria 8839
99 Ga0123356_10004847 3300010049 Bacteria 13841
100 Ga0123356_10012343 3300010049 Bacteria 8296
101 Ga0123356_10052174 3300010049 Bacteria 3804
102 Ga0123353_10001121 3300010167 Bacteria 32564
103 Ga0123353_10085564 3300010167 Bacteria 5078
104 Ga0123353_10112308 3300010167 Unclassified 4388
105 AustNasuHG_c1000012 3300000089 Bacteria 46647
106 JGI24695J34938_10017495 3300002450 Bacteria 3609
107 Ga0466705_472990 3300042612 Bacteria 8833
108 Ga0466710_289701 3300042613 Bacteria 1360
109 Ga0466711_029128 3300042615 Bacteria 8258
110 Ga0466715_231365 3300042616 Bacteria 20485
111 Ga0466726_340039 3300042619 Bacteria 19895
112 Ga0466705_018141 3300042612 Bacteria 98086
113 Ga0466705_227630 3300042612 Bacteria 3153
114 Ga0466733_031423 3300042659 Bacteria 19342
115 Ga0466702_101244 3300042635 Bacteria 64228
116 Ga0466703_425866 3300042636 Unclassified 5438
117 Ga0466704_220247 3300042643 Bacteria 26948
118 Ga0466704_486368 3300042643 Bacteria 7808
119 Ga0466704_548342 3300042643 Bacteria 2855
120 Ga0466727_089758 3300042655 Bacteria 159388
121 Ga0466706_057917 3300042599 Bacteria 3748
122 Ga0466707_076653 3300042601 Bacteria 3609
123 Ga0415639_004562 3300038395 Bacteria 38223
124 Ga0415639_004820 3300038395 Bacteria 24670
125 Ga0415639_008617 3300038395 Bacteria 23471
126 Ga0415639_030104 3300038395 Bacteria 5035
127 Ga0466691_012680 3300042593 Bacteria 18458
128 Ga0123356_10075305 3300010049 Bacteria 3179
129 Ga0123353_10074404 3300010167 Bacteria 5461
130 IMNBL1DRAFT_c0000016 3300000062 Bacteria 178436
131 Ga0466711_125898 3300042615 Bacteria 2387
132 Ga0466715_334969 3300042616 Bacteria 10133
133 Ga0466723_308638 3300042618 Bacteria 2114
134 Ga0466726_286842 3300042619 Bacteria 6661
135 Ga0466708_029517 3300042652 Bacteria 5869
136 Ga0466706_045960 3300042599 Bacteria 4529
137 Ga0466706_086710 3300042599 Bacteria 2435
138 Ga0466706_103570 3300042599 Bacteria 9069
139 Ga0466700_161195 3300042600 Bacteria 1387
140 Ga0466700_211271 3300042600 Bacteria 1703
141 Ga0466707_133116 3300042601 Bacteria 15599
142 Ga0466707_166011 3300042601 Bacteria 10838
143 Ga0466707_179708 3300042601 Bacteria 2284
144 Ga0466713_008917 3300042602 Bacteria 107916
145 Ga0466713_065934 3300042602 Bacteria 12836
146 Ga0466713_129989 3300042602 Unclassified 1640
147 Ga0466719_209195 3300042606 Bacteria 4661
148 Ga0466719_343242 3300042606 Bacteria 1491
149 Ga0466721_063560 3300042608 Bacteria 3394
150 Ga0466657_045394 3300042582 Bacteria 2049
151 Ga0123356_10019952 3300010049 Bacteria 6349
152 Ga0123356_10205168 3300010049 Bacteria 2014
153 Ga0123353_10147654 3300010167 Bacteria 3758
154 2227474638 2225789004 Bacteria 22691
155 2227521856 2225789004 Bacteria 17125
156 IMNBL1DRAFT_c0000004 3300000062 Bacteria 271062
157 JGI24702J35022_10024797 3300002462 Bacteria 3239
158 Ga0466715_540871 3300042616 Bacteria 9367
159 Ga0466718_101046 3300042617 Bacteria 1221
160 Ga0466723_292338 3300042618 Bacteria 11710
161 Ga0466705_336692 3300042612 Bacteria 60317
162 Ga0466729_306709 3300042621 Bacteria 2601
163 Ga0466702_010060 3300042635 Bacteria 2824
164 Ga0466702_151057 3300042635 Bacteria 15023
165 Ga0466709_068776 3300042648 Bacteria 148378
166 Ga0466709_373822 3300042648 Bacteria 28609
167 Ga0466727_270890 3300042655 Bacteria 3050
168 Ga0466706_013184 3300042599 Bacteria 68045
169 Ga0466706_089686 3300042599 Bacteria 2884
170 Ga0466706_280970 3300042599 Bacteria 1843
171 Ga0466706_287776 3300042599 Bacteria 19085
172 Ga0466700_076918 3300042600 Bacteria 1437
173 Ga0466707_089638 3300042601 Bacteria 5348
174 Ga0466707_182769 3300042601 Bacteria 18126
175 Ga0466707_345888 3300042601 Bacteria 2141
176 Ga0466707_349311 3300042601 Bacteria 48831
177 Ga0466713_065317 3300042602 Bacteria 3649
178 Ga0466719_101182 3300042606 Bacteria 1569
179 Ga0466719_230061 3300042606 Bacteria 1442
180 Ga0415639_015377 3300038395 Bacteria 4247
181 Ga0415639_086829 3300038395 Bacteria 2698
182 Ga0415639_111382 3300038395 Bacteria 17806
183 Ga0466693_169341 3300042592 Bacteria 6501
184 Ga0123355_10213403 3300009826 Bacteria 2792
185 Ga0123355_10296130 3300009826 Bacteria 2212
186 Ga0123356_10001379 3300010049 Bacteria 26904
187 Ga0123356_10119261 3300010049 Bacteria 2563
188 Ga0123353_10267782 3300010167 Bacteria 2635
189 Ga0123353_10512653 3300010167 Bacteria 1743
190 IMNBL1DRAFT_c0001264 3300000062 Bacteria 19079
191 IMNBL1DRAFT_c0012190 3300000062 Bacteria 3951
192 JGI24702J35022_10000056 3300002462 Bacteria 46878
193 JGI24702J35022_10146815 3300002462 Bacteria 1320
194 JGI24703J35330_11748314 3300002501 Bacteria 13758
195 Ga0466711_020464 3300042615 Bacteria 3660
196 Ga0466711_344992 3300042615 Bacteria 71415
197 Ga0466723_045225 3300042618 Bacteria 13203
198 Ga0466723_100613 3300042618 Bacteria 21541
199 Ga0466723_357473 3300042618 Bacteria 1484
200 Ga0466726_350007 3300042619 Bacteria 45709
201 Ga0466705_141392 3300042612 Bacteria 2870
202 Ga0466703_425010 3300042636 Bacteria 4233
203 Ga0466706_202972 3300042599 Bacteria 22065
204 Ga0466707_381427 3300042601 Unclassified 3334
205 Ga0466722_001780 3300042609 Bacteria 4943
206 Ga0415639_001253 3300038395 Unclassified 4846
207 Ga0415639_008075 3300038395 Bacteria 28841
208 Ga0466693_426488 3300042592 Bacteria 2554
209 Ga0466691_211168 3300042593 Bacteria 6478
210 Ga0466694_373222 3300042594 Bacteria 7632
211 Ga0123355_10180138 3300009826 Unclassified 3138
212 Ga0123355_10217875 3300009826 Bacteria 2751
213 Ga0123356_10000117 3300010049 Bacteria 86612
214 Ga0123356_10029276 3300010049 Bacteria 5159
215 Ga0123356_10054451 3300010049 Bacteria 3726
216 Ga0123356_10082786 3300010049 Bacteria 3039
217 Ga0123353_10057441 3300010167 Bacteria 6234
218 2227108610 2225789004 Bacteria 9454
219 IMNBL1DRAFT_c0000098 3300000062 Bacteria 77289
220 IMNBL1DRAFT_c0004463 3300000062 Bacteria 8418
221 Ga0072940_1035353 3300005200 Bacteria 19206
222 Ga0466715_204084 3300042616 Bacteria 1518
223 Ga0466715_533916 3300042616 Bacteria 24126
224 Ga0466726_009474 3300042619 Bacteria 17587

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00180 Iso_dh Isocitrate/isopropylmalate dehydrogenase 7 391 0.87

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.