Protein Family IF05733
Metagenome
Isolate
272
Members
94
Samples
224
Scaffolds
393.67
Avg Length
Representative Sequence
- ID
- 3300042600|Ga0466700_250129|Ga0466700_250129_167_1507
- Length
- 446 aa
- Sequence
- MQKIKMTTPLVEMDGDEMTRILWQMIKDELLLPYIDLKTEYYDLGLKYRNETNDQVTFDSAEATIKYGVAVKCATITPNAARMSEYNLKKLWKSPNVTIRAILDGTVFRAPIVVNGIDPMVKCWQGPITIARHAYGDVYKNTEFIIAGAGKAELVFTAADGTVIRETIHDFDGPGILQSIHNTEKSIRSFAKACFNYALDTRQDLWFATKDTISQKYDHTFKDIVQEIFEKEYRERFAAAGIAYFYTLIDDAVARVMRDKGGFIWACKNYDGDVMSDMVSSAFGSLAMMTSVLVSPAGAYEYEAAHGTVQRHYYQHLEGKETSTNSVATIFAWTGALRKRGELDGLTGLVNFADALEKSTLATIESGKMTKDLALITTIKNAEILNSHDFIKAIHIPTNRRAGAMAAKQTYPRRPNKLLPIPHKKRITDIQAFHIHWRGASILPRC
Sample Types
Isolate
17.6%
Metagenome
82.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
36.2%
Termitidae
26.6%
Blattidae
14.9%
Kalotermitidae
13.8%
Termopsidae
3.2%
Rhinotermitidae
2.1%
Passalidae
2.1%
Hodotermitidae
1.1%
Taxonomy
Archaea
0
Bacteria
263
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 2 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 3 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 4 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 5 | 2820254385 | Unclassified Firmicutes Th196P3bin54 | Isolate | Unclassified |
| 6 | 2820339298 | Unclassified Firmicutes Nt197P3bin68 | Isolate | Unclassified |
| 7 | 2820447167 | Unclassified Firmicutes Lab288P3bin192 | Isolate | Unclassified |
| 8 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 18 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 19 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 20 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 21 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 22 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 26 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 27 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 28 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 31 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 32 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 33 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 34 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 35 | 2820569216 | Unclassified Firmicutes Emb289P3bin33 | Isolate | Unclassified |
| 36 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 37 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 38 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 39 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 40 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 41 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 42 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 43 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 44 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 45 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 46 | 2820463629 | Unclassified Firmicutes Lab288P3bin124 | Isolate | Unclassified |
| 47 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 48 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 49 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 50 | 2819998259 | Unclassified Spirochaetes Nc150P4bin23 | Isolate | Unclassified |
| 51 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 52 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 53 | 2820800812 | Unclassified Actinobacteria Th196P4bin28 | Isolate | Unclassified |
| 54 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 55 | 2820014844 | Unclassified Spirochaetes Nt197P3bin95 | Isolate | Unclassified |
| 56 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 57 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 58 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 59 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 60 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 61 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 62 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 63 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 64 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 65 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 66 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 67 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 68 | 2820255904 | Unclassified Firmicutes Th196P3bin48 | Isolate | Unclassified |
| 69 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 70 | 2820360414 | Unclassified Firmicutes Nt197P3bin121 | Isolate | Unclassified |
| 71 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 72 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 73 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 74 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 75 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 76 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 77 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 78 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 79 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 80 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 81 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 82 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 83 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 84 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 85 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 86 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 87 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 88 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 89 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 90 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 91 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 92 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 93 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 94 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_097028 | 3300042612 | Bacteria | 11533 |
| 2 | Ga0466704_168208 | 3300042643 | Bacteria | 28884 |
| 3 | Ga0466708_049527 | 3300042652 | Bacteria | 11405 |
| 4 | Ga0466706_009181 | 3300042599 | Unclassified | 10337 |
| 5 | Ga0466706_188526 | 3300042599 | Bacteria | 15141 |
| 6 | Ga0466706_238327 | 3300042599 | Bacteria | 15685 |
| 7 | Ga0466700_100190 | 3300042600 | Bacteria | 2839 |
| 8 | Ga0466707_319311 | 3300042601 | Bacteria | 64740 |
| 9 | Ga0466707_335813 | 3300042601 | Bacteria | 33089 |
| 10 | Ga0466713_038750 | 3300042602 | Bacteria | 43043 |
| 11 | Ga0466713_114126 | 3300042602 | Unclassified | 3560 |
| 12 | Ga0466717_043776 | 3300042604 | Bacteria | 4058 |
| 13 | Ga0466690_304202 | 3300042590 | Bacteria | 3108 |
| 14 | Ga0466696_429347 | 3300042596 | Bacteria | 12076 |
| 15 | Ga0123355_10113151 | 3300009826 | Bacteria | 4234 |
| 16 | Ga0123356_10000025 | 3300010049 | Bacteria | 166353 |
| 17 | Ga0123356_10022953 | 3300010049 | Bacteria | 5882 |
| 18 | Ga0123356_10023676 | 3300010049 | Bacteria | 5777 |
| 19 | Ga0123353_10042172 | 3300010167 | Bacteria | 7215 |
| 20 | Ga0123353_10316872 | 3300010167 | Bacteria | 2369 |
| 21 | Ga0123353_10353926 | 3300010167 | Bacteria | 2211 |
| 22 | Ga0123353_10389067 | 3300010167 | Bacteria | 2081 |
| 23 | Ga0123354_10219225 | 3300010882 | Bacteria | 2027 |
| 24 | JGI24705J35276_12225080 | 3300002504 | Bacteria | 2679 |
| 25 | Ga0068302_10013988 | 3300005071 | Bacteria | 12980 |
| 26 | Ga0466711_017116 | 3300042615 | Bacteria | 84050 |
| 27 | Ga0466711_401690 | 3300042615 | Bacteria | 1551 |
| 28 | Ga0466705_046448 | 3300042612 | Bacteria | 12793 |
| 29 | Ga0466708_313266 | 3300042652 | Bacteria | 17281 |
| 30 | Ga0466706_003003 | 3300042599 | Bacteria | 3349 |
| 31 | Ga0466706_089758 | 3300042599 | Bacteria | 7917 |
| 32 | Ga0466706_125295 | 3300042599 | Bacteria | 3607 |
| 33 | Ga0466706_267194 | 3300042599 | Bacteria | 8347 |
| 34 | Ga0466700_250129 | 3300042600 | Bacteria | 3436 |
| 35 | Ga0466707_242321 | 3300042601 | Bacteria | 2064 |
| 36 | Ga0466713_105987 | 3300042602 | Bacteria | 56927 |
| 37 | Ga0466713_114798 | 3300042602 | Bacteria | 2439 |
| 38 | Ga0466719_008873 | 3300042606 | Bacteria | 7561 |
| 39 | Ga0466721_391751 | 3300042608 | Bacteria | 12745 |
| 40 | Ga0466722_088366 | 3300042609 | Bacteria | 8524 |
| 41 | Ga0466722_156272 | 3300042609 | Bacteria | 6775 |
| 42 | Ga0415639_002797 | 3300038395 | Bacteria | 11795 |
| 43 | Ga0466696_284476 | 3300042596 | Bacteria | 30745 |
| 44 | Ga0123356_10008044 | 3300010049 | Bacteria | 10494 |
| 45 | Ga0123356_10547306 | 3300010049 | Bacteria | 1318 |
| 46 | Ga0123353_10233980 | 3300010167 | Bacteria | 2861 |
| 47 | Ga0123353_10372346 | 3300010167 | Bacteria | 2141 |
| 48 | AustNasuHG_c1005454 | 3300000089 | Bacteria | 4546 |
| 49 | Ga0068305_10001878 | 3300005083 | Bacteria | 41327 |
| 50 | Ga0466723_128410 | 3300042618 | Bacteria | 3916 |
| 51 | Ga0466723_141786 | 3300042618 | Bacteria | 23960 |
| 52 | Ga0466726_373558 | 3300042619 | Bacteria | 5403 |
| 53 | Ga0466705_117048 | 3300042612 | Bacteria | 3869 |
| 54 | Ga0466705_375992 | 3300042612 | Bacteria | 6956 |
| 55 | Ga0466733_065374 | 3300042659 | Bacteria | 13383 |
| 56 | Ga0466733_144102 | 3300042659 | Bacteria | 37735 |
| 57 | Ga0466702_328262 | 3300042635 | Bacteria | 3571 |
| 58 | Ga0466704_401042 | 3300042643 | Bacteria | 6095 |
| 59 | Ga0466704_619471 | 3300042643 | Bacteria | 40828 |
| 60 | Ga0466706_016230 | 3300042599 | Bacteria | 7447 |
| 61 | Ga0466706_250408 | 3300042599 | Bacteria | 38512 |
| 62 | Ga0466706_263200 | 3300042599 | Bacteria | 5961 |
| 63 | Ga0466706_276776 | 3300042599 | Bacteria | 31951 |
| 64 | Ga0466707_079678 | 3300042601 | Bacteria | 35130 |
| 65 | Ga0466707_312796 | 3300042601 | Unclassified | 5964 |
| 66 | Ga0466716_105965 | 3300042605 | Bacteria | 4526 |
| 67 | Ga0466719_154243 | 3300042606 | Bacteria | 12224 |
| 68 | Ga0466721_326403 | 3300042608 | Bacteria | 2509 |
| 69 | Ga0415639_001252 | 3300038395 | Bacteria | 16025 |
| 70 | Ga0415639_006490 | 3300038395 | Bacteria | 35011 |
| 71 | Ga0466693_002468 | 3300042592 | Bacteria | 1799 |
| 72 | Ga0466691_049117 | 3300042593 | Bacteria | 4062 |
| 73 | Ga0466691_186074 | 3300042593 | Bacteria | 17073 |
| 74 | Ga0123356_10000267 | 3300010049 | Bacteria | 60216 |
| 75 | Ga0123353_10007382 | 3300010167 | Bacteria | 14845 |
| 76 | Ga0123353_10015935 | 3300010167 | Bacteria | 10958 |
| 77 | Ga0123353_10030013 | 3300010167 | Bacteria | 8391 |
| 78 | Ga0123353_10423322 | 3300010167 | Bacteria | 1972 |
| 79 | Ga0123353_10586427 | 3300010167 | Bacteria | 1598 |
| 80 | Ga0123354_10088765 | 3300010882 | Bacteria | 4297 |
| 81 | Ga0466711_054678 | 3300042615 | Bacteria | 13647 |
| 82 | Ga0466715_596696 | 3300042616 | Bacteria | 9450 |
| 83 | Ga0466726_221260 | 3300042619 | Bacteria | 1690 |
| 84 | Ga0466729_144867 | 3300042621 | Bacteria | 2442 |
| 85 | Ga0466705_043866 | 3300042612 | Bacteria | 2781 |
| 86 | Ga0466733_067446 | 3300042659 | Bacteria | 2409 |
| 87 | Ga0466702_277512 | 3300042635 | Bacteria | 2013 |
| 88 | Ga0466703_171715 | 3300042636 | Bacteria | 7365 |
| 89 | Ga0466727_167370 | 3300042655 | Bacteria | 11748 |
| 90 | Ga0466706_130678 | 3300042599 | Bacteria | 70477 |
| 91 | Ga0466706_243559 | 3300042599 | Bacteria | 3067 |
| 92 | Ga0466706_247257 | 3300042599 | Bacteria | 4027 |
| 93 | Ga0466707_128989 | 3300042601 | Bacteria | 3401 |
| 94 | Ga0466714_079484 | 3300042603 | Bacteria | 2021 |
| 95 | Ga0466716_123880 | 3300042605 | Bacteria | 6381 |
| 96 | Ga0415639_010082 | 3300038395 | Bacteria | 3418 |
| 97 | Ga0415639_052974 | 3300038395 | Bacteria | 14184 |
| 98 | Ga0466696_022689 | 3300042596 | Bacteria | 8839 |
| 99 | Ga0123356_10004847 | 3300010049 | Bacteria | 13841 |
| 100 | Ga0123356_10012343 | 3300010049 | Bacteria | 8296 |
| 101 | Ga0123356_10052174 | 3300010049 | Bacteria | 3804 |
| 102 | Ga0123353_10001121 | 3300010167 | Bacteria | 32564 |
| 103 | Ga0123353_10085564 | 3300010167 | Bacteria | 5078 |
| 104 | Ga0123353_10112308 | 3300010167 | Unclassified | 4388 |
| 105 | AustNasuHG_c1000012 | 3300000089 | Bacteria | 46647 |
| 106 | JGI24695J34938_10017495 | 3300002450 | Bacteria | 3609 |
| 107 | Ga0466705_472990 | 3300042612 | Bacteria | 8833 |
| 108 | Ga0466710_289701 | 3300042613 | Bacteria | 1360 |
| 109 | Ga0466711_029128 | 3300042615 | Bacteria | 8258 |
| 110 | Ga0466715_231365 | 3300042616 | Bacteria | 20485 |
| 111 | Ga0466726_340039 | 3300042619 | Bacteria | 19895 |
| 112 | Ga0466705_018141 | 3300042612 | Bacteria | 98086 |
| 113 | Ga0466705_227630 | 3300042612 | Bacteria | 3153 |
| 114 | Ga0466733_031423 | 3300042659 | Bacteria | 19342 |
| 115 | Ga0466702_101244 | 3300042635 | Bacteria | 64228 |
| 116 | Ga0466703_425866 | 3300042636 | Unclassified | 5438 |
| 117 | Ga0466704_220247 | 3300042643 | Bacteria | 26948 |
| 118 | Ga0466704_486368 | 3300042643 | Bacteria | 7808 |
| 119 | Ga0466704_548342 | 3300042643 | Bacteria | 2855 |
| 120 | Ga0466727_089758 | 3300042655 | Bacteria | 159388 |
| 121 | Ga0466706_057917 | 3300042599 | Bacteria | 3748 |
| 122 | Ga0466707_076653 | 3300042601 | Bacteria | 3609 |
| 123 | Ga0415639_004562 | 3300038395 | Bacteria | 38223 |
| 124 | Ga0415639_004820 | 3300038395 | Bacteria | 24670 |
| 125 | Ga0415639_008617 | 3300038395 | Bacteria | 23471 |
| 126 | Ga0415639_030104 | 3300038395 | Bacteria | 5035 |
| 127 | Ga0466691_012680 | 3300042593 | Bacteria | 18458 |
| 128 | Ga0123356_10075305 | 3300010049 | Bacteria | 3179 |
| 129 | Ga0123353_10074404 | 3300010167 | Bacteria | 5461 |
| 130 | IMNBL1DRAFT_c0000016 | 3300000062 | Bacteria | 178436 |
| 131 | Ga0466711_125898 | 3300042615 | Bacteria | 2387 |
| 132 | Ga0466715_334969 | 3300042616 | Bacteria | 10133 |
| 133 | Ga0466723_308638 | 3300042618 | Bacteria | 2114 |
| 134 | Ga0466726_286842 | 3300042619 | Bacteria | 6661 |
| 135 | Ga0466708_029517 | 3300042652 | Bacteria | 5869 |
| 136 | Ga0466706_045960 | 3300042599 | Bacteria | 4529 |
| 137 | Ga0466706_086710 | 3300042599 | Bacteria | 2435 |
| 138 | Ga0466706_103570 | 3300042599 | Bacteria | 9069 |
| 139 | Ga0466700_161195 | 3300042600 | Bacteria | 1387 |
| 140 | Ga0466700_211271 | 3300042600 | Bacteria | 1703 |
| 141 | Ga0466707_133116 | 3300042601 | Bacteria | 15599 |
| 142 | Ga0466707_166011 | 3300042601 | Bacteria | 10838 |
| 143 | Ga0466707_179708 | 3300042601 | Bacteria | 2284 |
| 144 | Ga0466713_008917 | 3300042602 | Bacteria | 107916 |
| 145 | Ga0466713_065934 | 3300042602 | Bacteria | 12836 |
| 146 | Ga0466713_129989 | 3300042602 | Unclassified | 1640 |
| 147 | Ga0466719_209195 | 3300042606 | Bacteria | 4661 |
| 148 | Ga0466719_343242 | 3300042606 | Bacteria | 1491 |
| 149 | Ga0466721_063560 | 3300042608 | Bacteria | 3394 |
| 150 | Ga0466657_045394 | 3300042582 | Bacteria | 2049 |
| 151 | Ga0123356_10019952 | 3300010049 | Bacteria | 6349 |
| 152 | Ga0123356_10205168 | 3300010049 | Bacteria | 2014 |
| 153 | Ga0123353_10147654 | 3300010167 | Bacteria | 3758 |
| 154 | 2227474638 | 2225789004 | Bacteria | 22691 |
| 155 | 2227521856 | 2225789004 | Bacteria | 17125 |
| 156 | IMNBL1DRAFT_c0000004 | 3300000062 | Bacteria | 271062 |
| 157 | JGI24702J35022_10024797 | 3300002462 | Bacteria | 3239 |
| 158 | Ga0466715_540871 | 3300042616 | Bacteria | 9367 |
| 159 | Ga0466718_101046 | 3300042617 | Bacteria | 1221 |
| 160 | Ga0466723_292338 | 3300042618 | Bacteria | 11710 |
| 161 | Ga0466705_336692 | 3300042612 | Bacteria | 60317 |
| 162 | Ga0466729_306709 | 3300042621 | Bacteria | 2601 |
| 163 | Ga0466702_010060 | 3300042635 | Bacteria | 2824 |
| 164 | Ga0466702_151057 | 3300042635 | Bacteria | 15023 |
| 165 | Ga0466709_068776 | 3300042648 | Bacteria | 148378 |
| 166 | Ga0466709_373822 | 3300042648 | Bacteria | 28609 |
| 167 | Ga0466727_270890 | 3300042655 | Bacteria | 3050 |
| 168 | Ga0466706_013184 | 3300042599 | Bacteria | 68045 |
| 169 | Ga0466706_089686 | 3300042599 | Bacteria | 2884 |
| 170 | Ga0466706_280970 | 3300042599 | Bacteria | 1843 |
| 171 | Ga0466706_287776 | 3300042599 | Bacteria | 19085 |
| 172 | Ga0466700_076918 | 3300042600 | Bacteria | 1437 |
| 173 | Ga0466707_089638 | 3300042601 | Bacteria | 5348 |
| 174 | Ga0466707_182769 | 3300042601 | Bacteria | 18126 |
| 175 | Ga0466707_345888 | 3300042601 | Bacteria | 2141 |
| 176 | Ga0466707_349311 | 3300042601 | Bacteria | 48831 |
| 177 | Ga0466713_065317 | 3300042602 | Bacteria | 3649 |
| 178 | Ga0466719_101182 | 3300042606 | Bacteria | 1569 |
| 179 | Ga0466719_230061 | 3300042606 | Bacteria | 1442 |
| 180 | Ga0415639_015377 | 3300038395 | Bacteria | 4247 |
| 181 | Ga0415639_086829 | 3300038395 | Bacteria | 2698 |
| 182 | Ga0415639_111382 | 3300038395 | Bacteria | 17806 |
| 183 | Ga0466693_169341 | 3300042592 | Bacteria | 6501 |
| 184 | Ga0123355_10213403 | 3300009826 | Bacteria | 2792 |
| 185 | Ga0123355_10296130 | 3300009826 | Bacteria | 2212 |
| 186 | Ga0123356_10001379 | 3300010049 | Bacteria | 26904 |
| 187 | Ga0123356_10119261 | 3300010049 | Bacteria | 2563 |
| 188 | Ga0123353_10267782 | 3300010167 | Bacteria | 2635 |
| 189 | Ga0123353_10512653 | 3300010167 | Bacteria | 1743 |
| 190 | IMNBL1DRAFT_c0001264 | 3300000062 | Bacteria | 19079 |
| 191 | IMNBL1DRAFT_c0012190 | 3300000062 | Bacteria | 3951 |
| 192 | JGI24702J35022_10000056 | 3300002462 | Bacteria | 46878 |
| 193 | JGI24702J35022_10146815 | 3300002462 | Bacteria | 1320 |
| 194 | JGI24703J35330_11748314 | 3300002501 | Bacteria | 13758 |
| 195 | Ga0466711_020464 | 3300042615 | Bacteria | 3660 |
| 196 | Ga0466711_344992 | 3300042615 | Bacteria | 71415 |
| 197 | Ga0466723_045225 | 3300042618 | Bacteria | 13203 |
| 198 | Ga0466723_100613 | 3300042618 | Bacteria | 21541 |
| 199 | Ga0466723_357473 | 3300042618 | Bacteria | 1484 |
| 200 | Ga0466726_350007 | 3300042619 | Bacteria | 45709 |
| 201 | Ga0466705_141392 | 3300042612 | Bacteria | 2870 |
| 202 | Ga0466703_425010 | 3300042636 | Bacteria | 4233 |
| 203 | Ga0466706_202972 | 3300042599 | Bacteria | 22065 |
| 204 | Ga0466707_381427 | 3300042601 | Unclassified | 3334 |
| 205 | Ga0466722_001780 | 3300042609 | Bacteria | 4943 |
| 206 | Ga0415639_001253 | 3300038395 | Unclassified | 4846 |
| 207 | Ga0415639_008075 | 3300038395 | Bacteria | 28841 |
| 208 | Ga0466693_426488 | 3300042592 | Bacteria | 2554 |
| 209 | Ga0466691_211168 | 3300042593 | Bacteria | 6478 |
| 210 | Ga0466694_373222 | 3300042594 | Bacteria | 7632 |
| 211 | Ga0123355_10180138 | 3300009826 | Unclassified | 3138 |
| 212 | Ga0123355_10217875 | 3300009826 | Bacteria | 2751 |
| 213 | Ga0123356_10000117 | 3300010049 | Bacteria | 86612 |
| 214 | Ga0123356_10029276 | 3300010049 | Bacteria | 5159 |
| 215 | Ga0123356_10054451 | 3300010049 | Bacteria | 3726 |
| 216 | Ga0123356_10082786 | 3300010049 | Bacteria | 3039 |
| 217 | Ga0123353_10057441 | 3300010167 | Bacteria | 6234 |
| 218 | 2227108610 | 2225789004 | Bacteria | 9454 |
| 219 | IMNBL1DRAFT_c0000098 | 3300000062 | Bacteria | 77289 |
| 220 | IMNBL1DRAFT_c0004463 | 3300000062 | Bacteria | 8418 |
| 221 | Ga0072940_1035353 | 3300005200 | Bacteria | 19206 |
| 222 | Ga0466715_204084 | 3300042616 | Bacteria | 1518 |
| 223 | Ga0466715_533916 | 3300042616 | Bacteria | 24126 |
| 224 | Ga0466726_009474 | 3300042619 | Bacteria | 17587 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00180 | Iso_dh | Isocitrate/isopropylmalate dehydrogenase | 7 | 391 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.