Protein Family IF05704
Metagenome
Isolate
252
Members
133
Samples
178
Scaffolds
55.97
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_284770|Ga0466706_284770_1953_2153
- Length
- 66 aa
- Sequence
- VTGEERFVNKLASKAADVRPKITLACTVCKERNYITKKNRRNDPNRMELNKFCPRCGKHTPHRESR
Sample Types
Isolate
29.4%
Metagenome
70.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
30.4%
Termitidae
25.6%
Formicidae
12.0%
Kalotermitidae
8.8%
Culicidae
4.0%
Elmidae
3.2%
Tenebrionidae
2.4%
Termopsidae
2.4%
Rhinotermitidae
1.6%
Hydrophilidae
1.6%
Cambaridae
1.6%
Curculionidae
0.8%
Thomisidae
0.8%
Hodotermitidae
0.8%
Cimicidae
0.8%
Cerambycidae
0.8%
Siricidae
0.8%
Reduviidae
0.8%
Armadillidiidae
0.8%
Taxonomy
Archaea
0
Bacteria
216
Eukaryota
0
Viruses
0
Unclassified
36
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 2 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 3 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 4 | 2820914081 | Unclassified Actinobacteria Emb289P3bin87 | Isolate | Unclassified |
| 5 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 6 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 11 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 16 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 17 | 2820814774 | Unclassified Actinobacteria Nt197P3bin39 | Isolate | Unclassified |
| 18 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 19 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 20 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 21 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 22 | 2864964650 | Tsukamurella ocularis S00236 | Isolate | Elmidae |
| 23 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 24 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 27 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 28 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 29 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 34 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 35 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 38 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 39 | 2820807258 | Unclassified Actinobacteria Nt197P3bin90 | Isolate | Unclassified |
| 40 | 2820818506 | Unclassified Actinobacteria Nt197P3bin3 | Isolate | Unclassified |
| 41 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 42 | 2820922474 | Unclassified Actinobacteria Emb289P3bin154 | Isolate | Unclassified |
| 43 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 44 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 45 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 46 | 646564587 | Tsukamurella paurometabola 33, DSM 20162 | Isolate | Cimicidae |
| 47 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 48 | 8077775691 | Tsukamurella sp. PLM1 | Isolate | Formicidae |
| 49 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 50 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 51 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 52 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 53 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 54 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 55 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 56 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 57 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 58 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 59 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 60 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 61 | 2820838073 | Unclassified Actinobacteria Lab288P4bin27 | Isolate | Unclassified |
| 62 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 63 | 2821314491 | Unclassified Actinobacteria Lab288P4bin49 | Isolate | Unclassified |
| 64 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 65 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 66 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 67 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 68 | 2863397684 | Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) | Isolate | Unclassified |
| 69 | 2864773010 | Tsukamurella ocularis S00022 | Isolate | Elmidae |
| 70 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 71 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 72 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 73 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 74 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 75 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 76 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 77 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 78 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 79 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 80 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 81 | 2820867525 | Unclassified Actinobacteria Lab288P3bin128 | Isolate | Unclassified |
| 82 | 2820903739 | Unclassified Actinobacteria Emb289P4bin49 | Isolate | Unclassified |
| 83 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 84 | 2864918810 | Tsukamurella ocularis S00175 | Isolate | Elmidae |
| 85 | 2900368070 | Nocardia aurantia RB56 | Isolate | Termitidae |
| 86 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 87 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 88 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 89 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 90 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 91 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 92 | 2820897376 | Unclassified Actinobacteria Lab288P1bin101 | Isolate | Unclassified |
| 93 | 2856652821 | Actinomadura rubteroloni RB29 | Isolate | Unclassified |
| 94 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 95 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 96 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 97 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 98 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 99 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 100 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 101 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 102 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 103 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 104 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 105 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 106 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 107 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 108 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 109 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 110 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 111 | 2820834831 | Unclassified Actinobacteria Lab288P4bin79 | Isolate | Unclassified |
| 112 | 2820840446 | Unclassified Actinobacteria Lab288P4bin17 | Isolate | Unclassified |
| 113 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 114 | 2820899690 | Unclassified Actinobacteria Emb289P4bin9 | Isolate | Unclassified |
| 115 | 2852016966 | Micromonospora polyrhachis DSM 45886 | Isolate | Unclassified |
| 116 | 2873603790 | Tessaracoccus coleopterorum HDW20 | Isolate | Hydrophilidae |
| 117 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 118 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 119 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 120 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 121 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 122 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 123 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 124 | 2545824723 | Rhodococcus rhodnii LMG 5362 | Isolate | Reduviidae |
| 125 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 126 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 127 | 2820829137 | Unclassified Actinobacteria Nc150P5bin2 | Isolate | Unclassified |
| 128 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 129 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 130 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 131 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 132 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 133 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_077161 | 3300042611 | Bacteria | 1050 |
| 2 | Ga0466705_152139 | 3300042612 | Unclassified | 4604 |
| 3 | Ga0466705_283107 | 3300042612 | Unclassified | 2182 |
| 4 | Ga0466734_045243 | 3300042623 | Bacteria | 1208 |
| 5 | Ga0466703_329734 | 3300042636 | Bacteria | 2228 |
| 6 | Ga0466727_002417 | 3300042655 | Unclassified | 1151 |
| 7 | Ga0466723_015044 | 3300042618 | Bacteria | 2515 |
| 8 | Ga0466728_245094 | 3300042620 | Bacteria | 2545 |
| 9 | Ga0123357_10012972 | 3300009784 | Bacteria | 10775 |
| 10 | Ga0123357_10057054 | 3300009784 | Bacteria | 5249 |
| 11 | Ga0123356_10074791 | 3300010049 | Bacteria | 3189 |
| 12 | Ga0123353_10937477 | 3300010167 | Unclassified | 1173 |
| 13 | Ga0123353_11154832 | 3300010167 | Bacteria | 1022 |
| 14 | Ga0466706_267798 | 3300042599 | Bacteria | 2502 |
| 15 | Ga0466707_271863 | 3300042601 | Bacteria | 41261 |
| 16 | Ga0466716_530273 | 3300042605 | Bacteria | 10198 |
| 17 | Ga0466722_207962 | 3300042609 | Bacteria | 22815 |
| 18 | AustNasuHG_c1000390 | 3300000089 | Bacteria | 15232 |
| 19 | JGI24705J35276_12209033 | 3300002504 | Bacteria | 1788 |
| 20 | JGI24699J35502_10983983 | 3300002509 | Bacteria | 1283 |
| 21 | Ga0072941_1074101 | 3300005201 | Bacteria | 8389 |
| 22 | Ga0160432_100214 | 3300012818 | Bacteria | 49653 |
| 23 | Ga0160448_105940 | 3300012854 | Bacteria | 3117 |
| 24 | Ga0160436_1024835 | 3300012861 | Unclassified | 1082 |
| 25 | Ga0466696_440867 | 3300042596 | Bacteria | 2425 |
| 26 | Ga0466733_005323 | 3300042659 | Unclassified | 10701 |
| 27 | Ga0562375_2354 | 3300056856 | Bacteria | 21387 |
| 28 | Ga0466734_106881 | 3300042623 | Bacteria | 3494 |
| 29 | Ga0466734_154847 | 3300042623 | Bacteria | 1244 |
| 30 | Ga0466730_088707 | 3300042625 | Unclassified | 3142 |
| 31 | Ga0466703_135101 | 3300042636 | Bacteria | 119691 |
| 32 | Ga0466704_034783 | 3300042643 | Bacteria | 163660 |
| 33 | Ga0466708_049949 | 3300042652 | Bacteria | 5143 |
| 34 | Ga0466725_220402 | 3300042654 | Bacteria | 4516 |
| 35 | Ga0466723_178656 | 3300042618 | Bacteria | 5158 |
| 36 | Ga0466728_165156 | 3300042620 | Bacteria | 2325 |
| 37 | Ga0466729_100524 | 3300042621 | Bacteria | 1092 |
| 38 | Ga0123357_10006708 | 3300009784 | Bacteria | 14107 |
| 39 | Ga0123357_10096898 | 3300009784 | Bacteria | 3819 |
| 40 | Ga0123355_11935262 | 3300009826 | Bacteria | 550 |
| 41 | Ga0123356_10164638 | 3300010049 | Bacteria | 2220 |
| 42 | Ga0123356_11092051 | 3300010049 | Unclassified | 966 |
| 43 | Ga0123353_12365915 | 3300010167 | Unclassified | 636 |
| 44 | Ga0123354_10072315 | 3300010882 | Unclassified | 4967 |
| 45 | Ga0123354_10220096 | 3300010882 | Bacteria | 2020 |
| 46 | Ga0466706_184764 | 3300042599 | Bacteria | 20406 |
| 47 | Ga0466707_330538 | 3300042601 | Unclassified | 1503 |
| 48 | JGI24699J35502_10846861 | 3300002509 | Bacteria | 948 |
| 49 | JGI24699J35502_11014796 | 3300002509 | Unclassified | 1419 |
| 50 | JGI24696J40584_12271962 | 3300002834 | Bacteria | 510 |
| 51 | Ga0074263_116363 | 3300005485 | Unclassified | 773 |
| 52 | Ga0160459_111976 | 3300012831 | Unclassified | 1019 |
| 53 | Ga0160447_101409 | 3300012849 | Unclassified | 9382 |
| 54 | Ga0466693_197064 | 3300042592 | Bacteria | 94166 |
| 55 | Ga0466696_435006 | 3300042596 | Unclassified | 1610 |
| 56 | Ga0466705_363018 | 3300042612 | Bacteria | 2039 |
| 57 | Ga0466704_285231 | 3300042643 | Bacteria | 1371 |
| 58 | Ga0466704_311098 | 3300042643 | Bacteria | 76427 |
| 59 | Ga0466724_33972 | 3300042649 | Bacteria | 12208 |
| 60 | Ga0466727_263974 | 3300042655 | Bacteria | 1110 |
| 61 | Ga0466710_008400 | 3300042613 | Bacteria | 6826 |
| 62 | Ga0466715_017612 | 3300042616 | Bacteria | 40510 |
| 63 | Ga0466715_607475 | 3300042616 | Bacteria | 1159 |
| 64 | Ga0466723_041651 | 3300042618 | Bacteria | 2668 |
| 65 | Ga0466723_240349 | 3300042618 | Unclassified | 9476 |
| 66 | Ga0466728_116348 | 3300042620 | Bacteria | 1315 |
| 67 | Ga0123356_10001023 | 3300010049 | Bacteria | 31111 |
| 68 | Ga0123356_10113504 | 3300010049 | Bacteria | 2621 |
| 69 | Ga0123353_12897561 | 3300010167 | Unclassified | 559 |
| 70 | Ga0160464_104394 | 3300012805 | Bacteria | 1785 |
| 71 | Ga0466707_274722 | 3300042601 | Bacteria | 1315 |
| 72 | Ga0466707_334896 | 3300042601 | Bacteria | 10519 |
| 73 | Ga0466713_088039 | 3300042602 | Bacteria | 7289 |
| 74 | Ga0466713_105765 | 3300042602 | Bacteria | 92337 |
| 75 | AustNasuHG_c1022427 | 3300000089 | Unclassified | 2028 |
| 76 | JGI24699J35502_11129824 | 3300002509 | Unclassified | 4849 |
| 77 | Ga0072940_1463781 | 3300005200 | Bacteria | 1658 |
| 78 | Ga0123357_10000192 | 3300009784 | Bacteria | 57301 |
| 79 | Ga0160431_110899 | 3300012828 | Bacteria | 1113 |
| 80 | Ga0466696_127504 | 3300042596 | Bacteria | 2594 |
| 81 | Ga0466733_063884 | 3300042659 | Bacteria | 94180 |
| 82 | Ga0466729_214193 | 3300042621 | Bacteria | 1604 |
| 83 | Ga0466730_018891 | 3300042625 | Bacteria | 23265 |
| 84 | Ga0466703_274039 | 3300042636 | Bacteria | 31452 |
| 85 | Ga0466703_403617 | 3300042636 | Bacteria | 11020 |
| 86 | Ga0466725_402376 | 3300042654 | Unclassified | 2499 |
| 87 | Ga0466727_270436 | 3300042655 | Bacteria | 3965 |
| 88 | Ga0466705_432267 | 3300042612 | Bacteria | 8713 |
| 89 | Ga0466710_421170 | 3300042613 | Bacteria | 1581 |
| 90 | Ga0466726_478976 | 3300042619 | Bacteria | 1155 |
| 91 | Ga0466728_220739 | 3300042620 | Bacteria | 4314 |
| 92 | Ga0123357_10900145 | 3300009784 | Unclassified | 572 |
| 93 | Ga0123356_11672103 | 3300010049 | Bacteria | 789 |
| 94 | Ga0123353_10782170 | 3300010167 | Bacteria | 1322 |
| 95 | Ga0123354_10003538 | 3300010882 | Bacteria | 21629 |
| 96 | Ga0123354_10110509 | 3300010882 | Unclassified | 3634 |
| 97 | Ga0466713_072111 | 3300042602 | Bacteria | 1427 |
| 98 | Ga0466713_103136 | 3300042602 | Bacteria | 1970 |
| 99 | AglaG_F499EG101EFG2Q | 2084038013 | Bacteria | 520 |
| 100 | JGI24702J35022_10843969 | 3300002462 | Bacteria | 571 |
| 101 | JGI24703J35330_11743688 | 3300002501 | Bacteria | 3962 |
| 102 | Ga0466691_095906 | 3300042593 | Bacteria | 7344 |
| 103 | Ga0466696_253023 | 3300042596 | Bacteria | 8455 |
| 104 | Ga0562378_0002 | 3300056814 | Bacteria | 3519472 |
| 105 | Ga0466729_220036 | 3300042621 | Bacteria | 1863 |
| 106 | Ga0466734_076893 | 3300042623 | Bacteria | 1139 |
| 107 | Ga0466730_068856 | 3300042625 | Bacteria | 20075 |
| 108 | Ga0466703_166237 | 3300042636 | Bacteria | 199031 |
| 109 | Ga0466703_417632 | 3300042636 | Bacteria | 1158 |
| 110 | Ga0466704_561041 | 3300042643 | Unclassified | 5702 |
| 111 | Ga0466727_172181 | 3300042655 | Unclassified | 11245 |
| 112 | Ga0466706_253929 | 3300042599 | Bacteria | 2939 |
| 113 | Ga0466700_393834 | 3300042600 | Bacteria | 18150 |
| 114 | Ga0466707_086104 | 3300042601 | Bacteria | 138731 |
| 115 | Ga0466713_047718 | 3300042602 | Bacteria | 1968 |
| 116 | Ga0466713_089995 | 3300042602 | Bacteria | 18549 |
| 117 | Ga0466713_123761 | 3300042602 | Bacteria | 17729 |
| 118 | Ga0466719_253393 | 3300042606 | Bacteria | 10757 |
| 119 | Ga0466698_061748 | 3300042610 | Bacteria | 3613 |
| 120 | JGI24705J35276_12221296 | 3300002504 | Bacteria | 2329 |
| 121 | JGI24699J35502_10350660 | 3300002509 | Bacteria | 540 |
| 122 | JGI24699J35502_11040471 | 3300002509 | Unclassified | 1572 |
| 123 | JGI24699J35502_11134164 | 3300002509 | Bacteria | 41878 |
| 124 | Ga0123357_10000204 | 3300009784 | Bacteria | 55847 |
| 125 | Ga0123357_10003109 | 3300009784 | Bacteria | 18848 |
| 126 | Ga0466657_031058 | 3300042582 | Bacteria | 11387 |
| 127 | Ga0466691_200516 | 3300042593 | Unclassified | 14178 |
| 128 | Ga0466733_073785 | 3300042659 | Bacteria | 65598 |
| 129 | Ga0466735_234952 | 3300042624 | Bacteria | 1479 |
| 130 | Ga0466710_309900 | 3300042613 | Unclassified | 1825 |
| 131 | Ga0466723_189822 | 3300042618 | Bacteria | 8337 |
| 132 | Ga0466723_232110 | 3300042618 | Bacteria | 32041 |
| 133 | Ga0123356_10000385 | 3300010049 | Bacteria | 50352 |
| 134 | Ga0123353_10000342 | 3300010167 | Bacteria | 56902 |
| 135 | Ga0123353_10004418 | 3300010167 | Bacteria | 18110 |
| 136 | Ga0123353_10915114 | 3300010167 | Bacteria | 1192 |
| 137 | Ga0123354_10987135 | 3300010882 | Unclassified | 543 |
| 138 | Ga0123354_11012585 | 3300010882 | Unclassified | 533 |
| 139 | Ga0466707_061285 | 3300042601 | Bacteria | 45531 |
| 140 | Ga0466707_330867 | 3300042601 | Bacteria | 5808 |
| 141 | Ga0466707_413335 | 3300042601 | Bacteria | 3584 |
| 142 | Ga0466713_092579 | 3300042602 | Bacteria | 53429 |
| 143 | Ga0466717_250013 | 3300042604 | Bacteria | 1689 |
| 144 | Ga0068305_10146797 | 3300005083 | Bacteria | 617 |
| 145 | Ga0160472_100006 | 3300012839 | Bacteria | 656551 |
| 146 | Ga0466734_132566 | 3300042623 | Bacteria | 1128 |
| 147 | Ga0466718_072760 | 3300042617 | Bacteria | 6152 |
| 148 | Ga0466723_096308 | 3300042618 | Bacteria | 2562 |
| 149 | Ga0466723_126758 | 3300042618 | Bacteria | 3812 |
| 150 | Ga0123355_11174152 | 3300009826 | Unclassified | 787 |
| 151 | Ga0123356_10431275 | 3300010049 | Bacteria | 1462 |
| 152 | Ga0123353_11671684 | 3300010167 | Bacteria | 799 |
| 153 | Ga0123354_10637455 | 3300010882 | Bacteria | 766 |
| 154 | Ga0466713_149114 | 3300042602 | Bacteria | 5374 |
| 155 | Ga0466716_130090 | 3300042605 | Unclassified | 2672 |
| 156 | Ga0466719_016723 | 3300042606 | Bacteria | 32213 |
| 157 | Ga0466719_479281 | 3300042606 | Bacteria | 3337 |
| 158 | AustNasuHG_c1026536 | 3300000089 | Unclassified | 1802 |
| 159 | AustNasuHG_c1057886 | 3300000089 | Bacteria | 770 |
| 160 | Ga0072940_1017776 | 3300005200 | Bacteria | 2823 |
| 161 | Ga0160456_100508 | 3300012820 | Unclassified | 12100 |
| 162 | Ga0466697_132300 | 3300042611 | Bacteria | 17122 |
| 163 | Ga0466705_084516 | 3300042612 | Bacteria | 2585 |
| 164 | Ga0466729_255004 | 3300042621 | Bacteria | 2267 |
| 165 | Ga0466729_281877 | 3300042621 | Bacteria | 4103 |
| 166 | Ga0466730_048478 | 3300042625 | Bacteria | 1529 |
| 167 | Ga0466703_139568 | 3300042636 | Unclassified | 1260 |
| 168 | Ga0466703_265965 | 3300042636 | Bacteria | 8915 |
| 169 | Ga0466708_144841 | 3300042652 | Bacteria | 18318 |
| 170 | Ga0123357_10408985 | 3300009784 | Bacteria | 1225 |
| 171 | Ga0123357_10640935 | 3300009784 | Bacteria | 792 |
| 172 | Ga0123357_11015765 | 3300009784 | Bacteria | 513 |
| 173 | Ga0123356_10001142 | 3300010049 | Bacteria | 29321 |
| 174 | Ga0123353_10125571 | 3300010167 | Bacteria | 4123 |
| 175 | Ga0466706_284770 | 3300042599 | Bacteria | 25134 |
| 176 | Ga0466707_072356 | 3300042601 | Unclassified | 5140 |
| 177 | Ga0466713_013806 | 3300042602 | Bacteria | 13196 |
| 178 | JGI24699J35502_11133323 | 3300002509 | Bacteria | 9847 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00471 | Ribosomal_L33 | Ribosomal protein L33 | 21 | 66 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.