Protein Family IF05686
Metagenome
Isolate
341
Members
92
Samples
294
Scaffolds
271.02
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_244555|Ga0466706_244555_1580_2398
- Length
- 272 aa
- Sequence
- MNEQFSIQGKVAVITGAGGVLGGSIAKSFVKNGAKVVALDIRQEQLDARVAELKAEGGDVIGFVGNVLDVESLEKVAQQIVAVWGRIDILLNIAGGNVPGATLEPDQPFFDMKIADWEKVTSLNINGTVYPSYVFSKIMAEQEGSSCIINVSSMTAYSAITRVPGYSLSKTGISNFTQWLATDMALKYGEKVRVNAIAPGFFIGDQNRKVLINPDGTLTDRSKKVMAKTPMKRFGDITELNGAVQFLCSDAASFITGVVLPIDGGFSAFSGV
Sample Types
Isolate
13.5%
Metagenome
86.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
26.1%
Termitidae
21.7%
Unclassified
17.4%
Kalotermitidae
15.2%
Rhinotermitidae
7.6%
Termopsidae
4.3%
Passalidae
2.2%
Armadillidiidae
2.2%
Hydrophilidae
2.2%
Hodotermitidae
1.1%
Taxonomy
Archaea
0
Bacteria
329
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 2 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 3 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 4 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 5 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 11 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 14 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 15 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 18 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 19 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 20 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 21 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 22 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 23 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 24 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 25 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 26 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 27 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 28 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 29 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 32 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 33 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 34 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 35 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 36 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 37 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 38 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 39 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 40 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 41 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 42 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 43 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 44 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 45 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 46 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 47 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 48 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 49 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 50 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 51 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 52 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 54 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 55 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 56 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 57 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 58 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 59 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 60 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 61 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 62 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 63 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 64 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 65 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 66 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 67 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 68 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 69 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 70 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 71 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 72 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 73 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 74 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 75 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 76 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 77 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 78 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 79 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 80 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 81 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 82 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 83 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 84 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 85 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 86 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 87 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 88 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 89 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 90 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 91 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 92 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160455_100069 | 3300012837 | Bacteria | 184978 |
| 2 | Ga0456237_0000050 | 3300041968 | Bacteria | 17325 |
| 3 | Ga0466690_244227 | 3300042590 | Bacteria | 8579 |
| 4 | Ga0466692_145660 | 3300042591 | Bacteria | 2359 |
| 5 | Ga0466691_035208 | 3300042593 | Bacteria | 19307 |
| 6 | Ga0466691_093192 | 3300042593 | Bacteria | 7346 |
| 7 | Ga0466691_214494 | 3300042593 | Bacteria | 20188 |
| 8 | Ga0466696_371823 | 3300042596 | Bacteria | 10442 |
| 9 | JGI24699J35502_11134124 | 3300002509 | Bacteria | 34130 |
| 10 | Ga0123357_10006437 | 3300009784 | Bacteria | 14332 |
| 11 | Ga0123354_10010225 | 3300010882 | Bacteria | 14443 |
| 12 | Ga0466706_208882 | 3300042599 | Bacteria | 2678 |
| 13 | Ga0466706_272316 | 3300042599 | Bacteria | 5024 |
| 14 | Ga0466707_028103 | 3300042601 | Bacteria | 16068 |
| 15 | Ga0466707_332189 | 3300042601 | Bacteria | 1568 |
| 16 | Ga0466713_129809 | 3300042602 | Bacteria | 5709 |
| 17 | Ga0466714_024711 | 3300042603 | Bacteria | 42103 |
| 18 | Ga0466719_228339 | 3300042606 | Bacteria | 1808 |
| 19 | Ga0466719_532666 | 3300042606 | Bacteria | 1080 |
| 20 | Ga0466722_035106 | 3300042609 | Bacteria | 44619 |
| 21 | Ga0466722_085264 | 3300042609 | Bacteria | 7063 |
| 22 | Ga0466697_096879 | 3300042611 | Bacteria | 330838 |
| 23 | Ga0466705_085762 | 3300042612 | Unclassified | 1583 |
| 24 | Ga0466705_311279 | 3300042612 | Bacteria | 23151 |
| 25 | Ga0466715_031058 | 3300042616 | Bacteria | 18036 |
| 26 | Ga0466715_273166 | 3300042616 | Bacteria | 2787 |
| 27 | Ga0466723_051649 | 3300042618 | Bacteria | 4837 |
| 28 | Ga0466729_124519 | 3300042621 | Bacteria | 6881 |
| 29 | Ga0466735_075614 | 3300042624 | Bacteria | 16269 |
| 30 | Ga0466735_098830 | 3300042624 | Bacteria | 1809 |
| 31 | Ga0466703_105441 | 3300042636 | Bacteria | 5474 |
| 32 | Ga0466703_111285 | 3300042636 | Bacteria | 2764 |
| 33 | Ga0466703_404236 | 3300042636 | Bacteria | 3750 |
| 34 | Ga0466704_052431 | 3300042643 | Unclassified | 5180 |
| 35 | Ga0466704_333463 | 3300042643 | Bacteria | 15938 |
| 36 | Ga0466704_403471 | 3300042643 | Bacteria | 2956 |
| 37 | Ga0466709_032551 | 3300042648 | Bacteria | 8337 |
| 38 | Ga0466708_195474 | 3300042652 | Bacteria | 6461 |
| 39 | Ga0466725_385820 | 3300042654 | Bacteria | 13675 |
| 40 | Ga0466690_051806 | 3300042590 | Bacteria | 3984 |
| 41 | Ga0466690_157295 | 3300042590 | Bacteria | 5196 |
| 42 | Ga0466692_034041 | 3300042591 | Bacteria | 4853 |
| 43 | Ga0466691_080653 | 3300042593 | Bacteria | 3448 |
| 44 | Ga0466691_117628 | 3300042593 | Bacteria | 15003 |
| 45 | Ga0466733_010958 | 3300042659 | Bacteria | 12720 |
| 46 | Ga0466733_218203 | 3300042659 | Bacteria | 3169 |
| 47 | IMNBL1DRAFT_c0006729 | 3300000062 | Bacteria | 6219 |
| 48 | JGI24702J35022_10001817 | 3300002462 | Bacteria | 13141 |
| 49 | JGI24696J40584_12959432 | 3300002834 | Bacteria | 5115 |
| 50 | Ga0068305_10202162 | 3300005083 | Bacteria | 4483 |
| 51 | Ga0123357_10012687 | 3300009784 | Bacteria | 10881 |
| 52 | Ga0123357_10367251 | 3300009784 | Unclassified | 1354 |
| 53 | Ga0466706_044418 | 3300042599 | Bacteria | 19614 |
| 54 | Ga0466706_184170 | 3300042599 | Bacteria | 30423 |
| 55 | Ga0466700_159036 | 3300042600 | Bacteria | 10259 |
| 56 | Ga0466707_038585 | 3300042601 | Bacteria | 11421 |
| 57 | Ga0466707_252281 | 3300042601 | Bacteria | 31745 |
| 58 | Ga0466707_342478 | 3300042601 | Bacteria | 10907 |
| 59 | Ga0466716_175724 | 3300042605 | Bacteria | 9919 |
| 60 | Ga0466716_243725 | 3300042605 | Bacteria | 9928 |
| 61 | Ga0466719_015538 | 3300042606 | Unclassified | 1599 |
| 62 | Ga0466719_026191 | 3300042606 | Bacteria | 7732 |
| 63 | Ga0466722_012357 | 3300042609 | Bacteria | 11530 |
| 64 | Ga0466722_020309 | 3300042609 | Bacteria | 4420 |
| 65 | Ga0466705_129948 | 3300042612 | Bacteria | 5280 |
| 66 | Ga0466705_336212 | 3300042612 | Bacteria | 2717 |
| 67 | Ga0466711_044951 | 3300042615 | Bacteria | 14666 |
| 68 | Ga0466715_245705 | 3300042616 | Bacteria | 35968 |
| 69 | Ga0466723_095684 | 3300042618 | Bacteria | 24004 |
| 70 | Ga0466723_312424 | 3300042618 | Bacteria | 3940 |
| 71 | Ga0466728_471166 | 3300042620 | Bacteria | 1627 |
| 72 | Ga0466729_294423 | 3300042621 | Bacteria | 2228 |
| 73 | Ga0466735_033476 | 3300042624 | Bacteria | 3513 |
| 74 | Ga0466735_054048 | 3300042624 | Bacteria | 1665 |
| 75 | Ga0466703_176566 | 3300042636 | Bacteria | 4777 |
| 76 | Ga0466704_049130 | 3300042643 | Bacteria | 3940 |
| 77 | Ga0466709_137811 | 3300042648 | Bacteria | 185438 |
| 78 | Ga0466709_340296 | 3300042648 | Bacteria | 2268 |
| 79 | Ga0466708_069051 | 3300042652 | Bacteria | 3101 |
| 80 | Ga0466727_044835 | 3300042655 | Bacteria | 5711 |
| 81 | Ga0160433_100240 | 3300012846 | Bacteria | 39651 |
| 82 | Ga0466690_184736 | 3300042590 | Bacteria | 19485 |
| 83 | Ga0466690_245823 | 3300042590 | Bacteria | 13554 |
| 84 | Ga0466692_149071 | 3300042591 | Bacteria | 2378 |
| 85 | Ga0466696_459672 | 3300042596 | Bacteria | 110905 |
| 86 | IMNBL1DRAFT_c0004089 | 3300000062 | Bacteria | 8920 |
| 87 | JGI24702J35022_10001771 | 3300002462 | Bacteria | 13335 |
| 88 | JGI24705J35276_12233867 | 3300002504 | Bacteria | 5117 |
| 89 | Ga0068305_10010843 | 3300005083 | Bacteria | 37341 |
| 90 | Ga0123357_10001618 | 3300009784 | Bacteria | 24111 |
| 91 | Ga0123357_10421153 | 3300009784 | Bacteria | 1191 |
| 92 | Ga0123354_10001921 | 3300010882 | Bacteria | 26450 |
| 93 | Ga0123354_10002723 | 3300010882 | Bacteria | 23700 |
| 94 | Ga0123354_10072193 | 3300010882 | Bacteria | 4973 |
| 95 | Ga0466701_034936 | 3300042598 | Bacteria | 51193 |
| 96 | Ga0466706_175629 | 3300042599 | Bacteria | 19829 |
| 97 | Ga0466700_091355 | 3300042600 | Bacteria | 21964 |
| 98 | Ga0466700_221114 | 3300042600 | Bacteria | 50828 |
| 99 | Ga0466707_382688 | 3300042601 | Bacteria | 19671 |
| 100 | Ga0466713_113728 | 3300042602 | Bacteria | 2289 |
| 101 | Ga0466716_539688 | 3300042605 | Bacteria | 7402 |
| 102 | Ga0466705_118348 | 3300042612 | Bacteria | 4275 |
| 103 | Ga0466705_134728 | 3300042612 | Bacteria | 2850 |
| 104 | Ga0466710_412082 | 3300042613 | Bacteria | 5635 |
| 105 | Ga0466711_051715 | 3300042615 | Bacteria | 1090 |
| 106 | Ga0466715_060283 | 3300042616 | Bacteria | 23431 |
| 107 | Ga0466715_107843 | 3300042616 | Bacteria | 16402 |
| 108 | Ga0466723_003141 | 3300042618 | Bacteria | 5846 |
| 109 | Ga0466723_069422 | 3300042618 | Bacteria | 22289 |
| 110 | Ga0466723_136135 | 3300042618 | Bacteria | 39501 |
| 111 | Ga0466726_002272 | 3300042619 | Bacteria | 4785 |
| 112 | Ga0466726_031204 | 3300042619 | Bacteria | 1724 |
| 113 | Ga0466726_372621 | 3300042619 | Bacteria | 1521 |
| 114 | Ga0466735_015139 | 3300042624 | Bacteria | 2210 |
| 115 | Ga0466735_027345 | 3300042624 | Bacteria | 2198 |
| 116 | Ga0466735_217432 | 3300042624 | Bacteria | 1445 |
| 117 | Ga0466730_012275 | 3300042625 | Bacteria | 4091 |
| 118 | Ga0466703_107689 | 3300042636 | Bacteria | 11215 |
| 119 | Ga0466704_279259 | 3300042643 | Bacteria | 2652 |
| 120 | Ga0466709_033772 | 3300042648 | Bacteria | 16857 |
| 121 | Ga0466708_127572 | 3300042652 | Bacteria | 2902 |
| 122 | Ga0466692_078265 | 3300042591 | Bacteria | 25872 |
| 123 | Ga0466692_117229 | 3300042591 | Bacteria | 56912 |
| 124 | Ga0466691_129674 | 3300042593 | Bacteria | 2251 |
| 125 | Ga0466696_203656 | 3300042596 | Bacteria | 11142 |
| 126 | 2227490470 | 2225789004 | Bacteria | 4107 |
| 127 | IMNBL1DRAFT_c0006130 | 3300000062 | Bacteria | 6658 |
| 128 | Ga0068302_10010441 | 3300005071 | Bacteria | 2163 |
| 129 | Ga0068305_10000339 | 3300005083 | Bacteria | 123240 |
| 130 | Ga0068305_10012635 | 3300005083 | Unclassified | 5090 |
| 131 | Ga0123356_10240493 | 3300010049 | Bacteria | 1881 |
| 132 | Ga0123354_10302637 | 3300010882 | Unclassified | 1509 |
| 133 | Ga0466701_023771 | 3300042598 | Bacteria | 19459 |
| 134 | Ga0466706_084622 | 3300042599 | Bacteria | 28514 |
| 135 | Ga0466700_362249 | 3300042600 | Bacteria | 4564 |
| 136 | Ga0466707_217907 | 3300042601 | Bacteria | 23324 |
| 137 | Ga0466707_300943 | 3300042601 | Bacteria | 7115 |
| 138 | Ga0466719_056775 | 3300042606 | Bacteria | 3623 |
| 139 | Ga0466719_289836 | 3300042606 | Bacteria | 2017 |
| 140 | Ga0466705_174137 | 3300042612 | Bacteria | 2443 |
| 141 | Ga0466705_232590 | 3300042612 | Bacteria | 7438 |
| 142 | Ga0466710_257866 | 3300042613 | Bacteria | 9772 |
| 143 | Ga0466711_008482 | 3300042615 | Bacteria | 9471 |
| 144 | Ga0466715_240953 | 3300042616 | Bacteria | 36603 |
| 145 | Ga0466728_283455 | 3300042620 | Bacteria | 6301 |
| 146 | Ga0466728_288944 | 3300042620 | Bacteria | 4902 |
| 147 | Ga0466734_021201 | 3300042623 | Bacteria | 3918 |
| 148 | Ga0466735_025103 | 3300042624 | Bacteria | 5661 |
| 149 | Ga0466735_229188 | 3300042624 | Bacteria | 9306 |
| 150 | Ga0466703_032081 | 3300042636 | Bacteria | 17325 |
| 151 | Ga0466703_109442 | 3300042636 | Bacteria | 6225 |
| 152 | Ga0466704_120294 | 3300042643 | Bacteria | 16016 |
| 153 | Ga0466704_306402 | 3300042643 | Bacteria | 17351 |
| 154 | Ga0466709_390589 | 3300042648 | Bacteria | 49108 |
| 155 | Ga0466708_246063 | 3300042652 | Bacteria | 25365 |
| 156 | Ga0466708_256133 | 3300042652 | Unclassified | 1121 |
| 157 | Ga0466727_286848 | 3300042655 | Bacteria | 1404 |
| 158 | Ga0466657_296869 | 3300042582 | Bacteria | 46620 |
| 159 | Ga0466690_256751 | 3300042590 | Bacteria | 42016 |
| 160 | Ga0466692_179942 | 3300042591 | Bacteria | 100786 |
| 161 | Ga0466696_112069 | 3300042596 | Bacteria | 7380 |
| 162 | Ga0466701_009529 | 3300042598 | Bacteria | 375690 |
| 163 | Ga0466733_087426 | 3300042659 | Bacteria | 1650 |
| 164 | IMNBL1DRAFT_c0003909 | 3300000062 | Bacteria | 9228 |
| 165 | IMNBL1DRAFT_c0017231 | 3300000062 | Bacteria | 3051 |
| 166 | JGI24699J35502_11134066 | 3300002509 | Bacteria | 28043 |
| 167 | Ga0123357_10002984 | 3300009784 | Bacteria | 19148 |
| 168 | Ga0466706_016460 | 3300042599 | Bacteria | 6714 |
| 169 | Ga0466706_039675 | 3300042599 | Bacteria | 8021 |
| 170 | Ga0466707_398084 | 3300042601 | Bacteria | 5088 |
| 171 | Ga0466713_071776 | 3300042602 | Bacteria | 4943 |
| 172 | Ga0466713_084435 | 3300042602 | Bacteria | 3754 |
| 173 | Ga0466713_124975 | 3300042602 | Bacteria | 10443 |
| 174 | Ga0466716_166965 | 3300042605 | Bacteria | 15672 |
| 175 | Ga0466716_430332 | 3300042605 | Bacteria | 14125 |
| 176 | Ga0466719_384738 | 3300042606 | Bacteria | 10524 |
| 177 | Ga0466722_156510 | 3300042609 | Bacteria | 8187 |
| 178 | Ga0466705_176841 | 3300042612 | Bacteria | 4778 |
| 179 | Ga0466710_269805 | 3300042613 | Bacteria | 7402 |
| 180 | Ga0466712_016831 | 3300042614 | Bacteria | 1064 |
| 181 | Ga0466715_482011 | 3300042616 | Bacteria | 12530 |
| 182 | Ga0466723_089568 | 3300042618 | Bacteria | 54083 |
| 183 | Ga0466735_048649 | 3300042624 | Bacteria | 1441 |
| 184 | Ga0466704_420855 | 3300042643 | Bacteria | 2041 |
| 185 | Ga0466708_082955 | 3300042652 | Bacteria | 55601 |
| 186 | Ga0466727_290618 | 3300042655 | Bacteria | 84490 |
| 187 | Ga0466690_191209 | 3300042590 | Bacteria | 2088 |
| 188 | Ga0466691_143438 | 3300042593 | Bacteria | 6940 |
| 189 | Ga0466696_062766 | 3300042596 | Bacteria | 9636 |
| 190 | Ga0466733_015084 | 3300042659 | Bacteria | 51247 |
| 191 | Ga0466733_131945 | 3300042659 | Bacteria | 5882 |
| 192 | 2227594078 | 2225789004 | Bacteria | 12781 |
| 193 | Ga0068302_10514489 | 3300005071 | Bacteria | 2194 |
| 194 | Ga0123357_10032187 | 3300009784 | Bacteria | 7120 |
| 195 | Ga0123357_10064225 | 3300009784 | Bacteria | 4907 |
| 196 | Ga0123357_10074617 | 3300009784 | Bacteria | 4486 |
| 197 | Ga0123354_10038562 | 3300010882 | Bacteria | 7415 |
| 198 | Ga0466706_244555 | 3300042599 | Bacteria | 2739 |
| 199 | Ga0466707_285735 | 3300042601 | Bacteria | 5907 |
| 200 | Ga0466713_007989 | 3300042602 | Bacteria | 2915 |
| 201 | Ga0466713_150871 | 3300042602 | Bacteria | 11473 |
| 202 | Ga0466714_047130 | 3300042603 | Bacteria | 63369 |
| 203 | Ga0466716_064981 | 3300042605 | Bacteria | 3975 |
| 204 | Ga0466719_036387 | 3300042606 | Bacteria | 2629 |
| 205 | Ga0466722_009162 | 3300042609 | Bacteria | 12567 |
| 206 | Ga0466722_010799 | 3300042609 | Bacteria | 3382 |
| 207 | Ga0466722_106485 | 3300042609 | Bacteria | 12243 |
| 208 | Ga0466705_422990 | 3300042612 | Bacteria | 7547 |
| 209 | Ga0466711_351328 | 3300042615 | Bacteria | 39391 |
| 210 | Ga0466715_023208 | 3300042616 | Bacteria | 18941 |
| 211 | Ga0466735_154780 | 3300042624 | Bacteria | 6459 |
| 212 | Ga0466703_265118 | 3300042636 | Bacteria | 4255 |
| 213 | Ga0466703_274384 | 3300042636 | Bacteria | 10736 |
| 214 | Ga0466709_070929 | 3300042648 | Bacteria | 2334 |
| 215 | Ga0466708_010142 | 3300042652 | Bacteria | 7423 |
| 216 | Ga0466727_251466 | 3300042655 | Bacteria | 5240 |
| 217 | Ga0466690_371004 | 3300042590 | Bacteria | 7307 |
| 218 | Ga0466691_079070 | 3300042593 | Bacteria | 13993 |
| 219 | Ga0466696_121107 | 3300042596 | Bacteria | 8497 |
| 220 | Ga0466696_258760 | 3300042596 | Bacteria | 39981 |
| 221 | Ga0466733_123711 | 3300042659 | Bacteria | 16378 |
| 222 | 2227482982 | 2225789004 | Bacteria | 21575 |
| 223 | 2227522430 | 2225789004 | Bacteria | 3313 |
| 224 | IMNBL1DRAFT_c0002178 | 3300000062 | Bacteria | 13832 |
| 225 | IMNBL1DRAFT_c0008533 | 3300000062 | Bacteria | 5204 |
| 226 | Ga0068305_10027724 | 3300005083 | Bacteria | 2116 |
| 227 | Ga0123354_10000501 | 3300010882 | Bacteria | 39365 |
| 228 | Ga0466706_147965 | 3300042599 | Bacteria | 4232 |
| 229 | Ga0466713_063524 | 3300042602 | Bacteria | 8482 |
| 230 | Ga0466713_071607 | 3300042602 | Bacteria | 71939 |
| 231 | Ga0466713_085471 | 3300042602 | Bacteria | 4905 |
| 232 | Ga0466713_113095 | 3300042602 | Bacteria | 77786 |
| 233 | Ga0466719_311363 | 3300042606 | Bacteria | 1735 |
| 234 | Ga0466722_006178 | 3300042609 | Bacteria | 11253 |
| 235 | Ga0466705_197163 | 3300042612 | Bacteria | 15512 |
| 236 | Ga0466705_498736 | 3300042612 | Bacteria | 3183 |
| 237 | Ga0466711_498926 | 3300042615 | Bacteria | 1871 |
| 238 | Ga0466711_506567 | 3300042615 | Bacteria | 1408 |
| 239 | Ga0466715_125136 | 3300042616 | Bacteria | 1757 |
| 240 | Ga0466715_163861 | 3300042616 | Bacteria | 20977 |
| 241 | Ga0466723_142910 | 3300042618 | Bacteria | 2434 |
| 242 | Ga0466726_068442 | 3300042619 | Bacteria | 18874 |
| 243 | Ga0466735_036272 | 3300042624 | Bacteria | 6061 |
| 244 | Ga0466735_064994 | 3300042624 | Unclassified | 2385 |
| 245 | Ga0466735_172885 | 3300042624 | Bacteria | 1625 |
| 246 | Ga0466703_146730 | 3300042636 | Bacteria | 5079 |
| 247 | Ga0466727_094894 | 3300042655 | Bacteria | 6624 |
| 248 | Ga0466727_160380 | 3300042655 | Bacteria | 2839 |
| 249 | Ga0466692_113908 | 3300042591 | Unclassified | 8920 |
| 250 | Ga0466691_125403 | 3300042593 | Bacteria | 6138 |
| 251 | Ga0466695_009046 | 3300042595 | Bacteria | 2641 |
| 252 | Ga0466733_185287 | 3300042659 | Bacteria | 5474 |
| 253 | 2227519067 | 2225789004 | Bacteria | 17590 |
| 254 | JGI24699J35502_11132754 | 3300002509 | Bacteria | 7549 |
| 255 | JGI24699J35502_11134220 | 3300002509 | Bacteria | 66991 |
| 256 | Ga0123357_10002435 | 3300009784 | Bacteria | 20755 |
| 257 | Ga0123357_10093421 | 3300009784 | Bacteria | 3910 |
| 258 | Ga0123357_10259840 | 3300009784 | Bacteria | 1838 |
| 259 | Ga0123354_10007001 | 3300010882 | Bacteria | 16861 |
| 260 | Ga0123354_10090190 | 3300010882 | Bacteria | 4247 |
| 261 | Ga0466706_133883 | 3300042599 | Bacteria | 39086 |
| 262 | Ga0466707_198291 | 3300042601 | Bacteria | 10236 |
| 263 | Ga0466707_274513 | 3300042601 | Unclassified | 1142 |
| 264 | Ga0466707_342999 | 3300042601 | Bacteria | 8185 |
| 265 | Ga0466713_029853 | 3300042602 | Bacteria | 6416 |
| 266 | Ga0466713_036295 | 3300042602 | Bacteria | 28721 |
| 267 | Ga0466713_119093 | 3300042602 | Bacteria | 59442 |
| 268 | Ga0466713_141088 | 3300042602 | Bacteria | 20493 |
| 269 | Ga0466716_219652 | 3300042605 | Bacteria | 15271 |
| 270 | Ga0466716_220547 | 3300042605 | Bacteria | 2661 |
| 271 | Ga0466716_375122 | 3300042605 | Bacteria | 1882 |
| 272 | Ga0466722_062829 | 3300042609 | Bacteria | 60409 |
| 273 | Ga0466698_081945 | 3300042610 | Bacteria | 2354 |
| 274 | Ga0466697_034775 | 3300042611 | Bacteria | 2320 |
| 275 | Ga0466697_240379 | 3300042611 | Bacteria | 1284 |
| 276 | Ga0466705_378213 | 3300042612 | Bacteria | 34876 |
| 277 | Ga0466711_088045 | 3300042615 | Bacteria | 7399 |
| 278 | Ga0466711_414242 | 3300042615 | Bacteria | 6464 |
| 279 | Ga0466715_061831 | 3300042616 | Bacteria | 11213 |
| 280 | Ga0466726_103120 | 3300042619 | Bacteria | 2597 |
| 281 | Ga0466728_304435 | 3300042620 | Bacteria | 29742 |
| 282 | Ga0466728_472022 | 3300042620 | Unclassified | 1522 |
| 283 | Ga0466728_481609 | 3300042620 | Bacteria | 1929 |
| 284 | Ga0466729_189117 | 3300042621 | Bacteria | 1857 |
| 285 | Ga0466735_064245 | 3300042624 | Bacteria | 4679 |
| 286 | Ga0466735_068864 | 3300042624 | Bacteria | 13806 |
| 287 | Ga0466704_029067 | 3300042643 | Bacteria | 3140 |
| 288 | Ga0466704_104549 | 3300042643 | Unclassified | 10475 |
| 289 | Ga0466704_152669 | 3300042643 | Bacteria | 16639 |
| 290 | Ga0466704_322550 | 3300042643 | Bacteria | 11009 |
| 291 | Ga0466704_578123 | 3300042643 | Bacteria | 7577 |
| 292 | Ga0466709_418557 | 3300042648 | Bacteria | 1602 |
| 293 | Ga0466708_005632 | 3300042652 | Bacteria | 3320 |
| 294 | Ga0466727_215102 | 3300042655 | Bacteria | 11333 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.