Protein Family IF05678
Metagenome
Isolate
173
Members
70
Samples
147
Scaffolds
251.42
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_229372|Ga0466706_229372_248_1090
- Length
- 280 aa
- Sequence
- MKRWDKLSILGLIIGIGAILGGQMLEGGHASSLWQPAALMIVLGGTTGAVLLQSPFVLFRRGIALLSWVFRPPVISLPRDIQLLLRFALIARREGFLALEHAIPADADPFVQRGLQLLVDGIEPAKLRDVLEAELTTFEDELRHAAKIWDSAGGYSPTIGILGAVLGLIHVMDNLADPAKLGLGIATAFVATVYGVGLANLVYIPIANKLKTLIAAQVARREMLIDGIAAIAVGENPRIIESRLTGYLPQKMSNQKAAHRAESRSTTPATSSPDSPQKID
Sample Types
Isolate
15.0%
Metagenome
85.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
29.9%
Termitidae
26.9%
Kalotermitidae
20.9%
Elmidae
9.0%
Rhinotermitidae
4.5%
Termopsidae
4.5%
Lysianassidae
1.5%
Hodotermitidae
1.5%
Passalidae
1.5%
Taxonomy
Archaea
0
Bacteria
166
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 2 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 3 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 13 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 14 | 2820131053 | Unclassified Proteobacteria Emb289P3bin8 | Isolate | Unclassified |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 27 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 28 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 29 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 30 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 33 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 34 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 35 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 36 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 37 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 38 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 39 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 40 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 41 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 42 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 43 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 44 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 45 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 46 | 2820075487 | Unclassified Proteobacteria Nt197P3bin122 | Isolate | Unclassified |
| 47 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 48 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 49 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 50 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 51 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 52 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 53 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 54 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 55 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 56 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 57 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 58 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 59 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 60 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 61 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 62 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 63 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 64 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 65 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 66 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 67 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 68 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 69 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 70 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_219231 | 3300042601 | Bacteria | 20636 |
| 2 | Ga0466716_166808 | 3300042605 | Bacteria | 20955 |
| 3 | Ga0466716_226302 | 3300042605 | Bacteria | 2990 |
| 4 | Ga0466719_054065 | 3300042606 | Bacteria | 43919 |
| 5 | Ga0466719_408905 | 3300042606 | Bacteria | 19998 |
| 6 | JGI24702J35022_10001142 | 3300002462 | Unclassified | 16507 |
| 7 | Ga0466712_080606 | 3300042614 | Bacteria | 15136 |
| 8 | Ga0466711_515045 | 3300042615 | Bacteria | 4502 |
| 9 | Ga0466723_107124 | 3300042618 | Bacteria | 13104 |
| 10 | Ga0466729_045478 | 3300042621 | Bacteria | 7744 |
| 11 | Ga0123354_10019250 | 3300010882 | Bacteria | 10719 |
| 12 | Ga0466703_043516 | 3300042636 | Bacteria | 2276 |
| 13 | Ga0466709_381522 | 3300042648 | Bacteria | 1861 |
| 14 | Ga0466708_447260 | 3300042652 | Bacteria | 6897 |
| 15 | Ga0466725_285254 | 3300042654 | Bacteria | 86814 |
| 16 | Ga0466707_086796 | 3300042601 | Bacteria | 101195 |
| 17 | Ga0466707_112869 | 3300042601 | Bacteria | 17585 |
| 18 | Ga0466719_480769 | 3300042606 | Bacteria | 9321 |
| 19 | Ga0466722_029240 | 3300042609 | Bacteria | 3315 |
| 20 | IMNBL1DRAFT_c0020785 | 3300000062 | Bacteria | 2645 |
| 21 | JGI24702J35022_10014765 | 3300002462 | Bacteria | 4304 |
| 22 | Ga0123357_10002961 | 3300009784 | Bacteria | 19199 |
| 23 | Ga0466710_260525 | 3300042613 | Bacteria | 27171 |
| 24 | Ga0466711_195520 | 3300042615 | Bacteria | 9930 |
| 25 | Ga0466718_083036 | 3300042617 | Bacteria | 2244 |
| 26 | Ga0466728_199627 | 3300042620 | Bacteria | 10051 |
| 27 | Ga0123357_10009266 | 3300009784 | Bacteria | 12408 |
| 28 | Ga0123353_10002133 | 3300010167 | Bacteria | 24463 |
| 29 | Ga0123353_10186235 | 3300010167 | Bacteria | 3282 |
| 30 | Ga0466690_020909 | 3300042590 | Bacteria | 3437 |
| 31 | Ga0466691_055761 | 3300042593 | Bacteria | 3508 |
| 32 | Ga0466734_166433 | 3300042623 | Bacteria | 4047 |
| 33 | Ga0466704_061300 | 3300042643 | Bacteria | 59338 |
| 34 | Ga0466709_399249 | 3300042648 | Unclassified | 1076 |
| 35 | Ga0466705_376811 | 3300042612 | Bacteria | 16884 |
| 36 | Ga0466707_036840 | 3300042601 | Bacteria | 1259 |
| 37 | Ga0466707_317426 | 3300042601 | Bacteria | 6043 |
| 38 | Ga0466713_080509 | 3300042602 | Bacteria | 20268 |
| 39 | Ga0466716_496339 | 3300042605 | Bacteria | 2371 |
| 40 | Ga0466716_532415 | 3300042605 | Unclassified | 3886 |
| 41 | Ga0466722_029539 | 3300042609 | Bacteria | 7964 |
| 42 | JGI24702J35022_10113077 | 3300002462 | Bacteria | 1494 |
| 43 | Ga0123357_10000150 | 3300009784 | Bacteria | 61848 |
| 44 | Ga0466711_477645 | 3300042615 | Bacteria | 2801 |
| 45 | Ga0466715_135746 | 3300042616 | Bacteria | 8213 |
| 46 | Ga0123356_10015947 | 3300010049 | Bacteria | 7185 |
| 47 | Ga0123356_10038569 | 3300010049 | Bacteria | 4452 |
| 48 | Ga0123356_10131483 | 3300010049 | Bacteria | 2453 |
| 49 | Ga0466691_038231 | 3300042593 | Bacteria | 51865 |
| 50 | Ga0466729_275726 | 3300042621 | Bacteria | 41765 |
| 51 | Ga0466734_106007 | 3300042623 | Bacteria | 5263 |
| 52 | Ga0466704_076270 | 3300042643 | Bacteria | 1957 |
| 53 | Ga0466708_095666 | 3300042652 | Bacteria | 3293 |
| 54 | Ga0466706_073504 | 3300042599 | Bacteria | 10036 |
| 55 | Ga0466707_134212 | 3300042601 | Bacteria | 56035 |
| 56 | Ga0466713_051013 | 3300042602 | Bacteria | 7998 |
| 57 | Ga0466719_038880 | 3300042606 | Bacteria | 14163 |
| 58 | Ga0466719_342248 | 3300042606 | Bacteria | 37604 |
| 59 | JGI24702J35022_10008975 | 3300002462 | Bacteria | 5635 |
| 60 | Ga0068305_10024478 | 3300005083 | Bacteria | 6558 |
| 61 | Ga0072941_1034257 | 3300005201 | Bacteria | 18483 |
| 62 | Ga0466712_032974 | 3300042614 | Bacteria | 1404 |
| 63 | Ga0466711_427238 | 3300042615 | Bacteria | 1146 |
| 64 | Ga0466715_142490 | 3300042616 | Bacteria | 66178 |
| 65 | Ga0466726_054270 | 3300042619 | Bacteria | 5233 |
| 66 | Ga0466726_469021 | 3300042619 | Bacteria | 7644 |
| 67 | Ga0466728_078707 | 3300042620 | Bacteria | 6279 |
| 68 | Ga0123354_10060476 | 3300010882 | Bacteria | 5602 |
| 69 | Ga0466657_369934 | 3300042582 | Bacteria | 14522 |
| 70 | Ga0466735_228639 | 3300042624 | Bacteria | 1132 |
| 71 | Ga0466703_206623 | 3300042636 | Bacteria | 1163 |
| 72 | Ga0466708_123811 | 3300042652 | Bacteria | 17627 |
| 73 | Ga0466727_242004 | 3300042655 | Bacteria | 18174 |
| 74 | Ga0466697_065264 | 3300042611 | Bacteria | 2242 |
| 75 | Ga0466705_022003 | 3300042612 | Bacteria | 8799 |
| 76 | Ga0466705_257618 | 3300042612 | Bacteria | 1643 |
| 77 | Ga0466715_369080 | 3300042616 | Bacteria | 23402 |
| 78 | Ga0466726_278257 | 3300042619 | Bacteria | 13445 |
| 79 | Ga0466657_054897 | 3300042582 | Bacteria | 3748 |
| 80 | Ga0466690_066435 | 3300042590 | Bacteria | 7687 |
| 81 | Ga0466692_157774 | 3300042591 | Bacteria | 50952 |
| 82 | Ga0466734_142851 | 3300042623 | Bacteria | 3568 |
| 83 | Ga0466703_181666 | 3300042636 | Bacteria | 1463 |
| 84 | Ga0466703_292925 | 3300042636 | Bacteria | 11341 |
| 85 | Ga0466725_018948 | 3300042654 | Bacteria | 15224 |
| 86 | Ga0466706_229372 | 3300042599 | Bacteria | 4268 |
| 87 | Ga0466707_127683 | 3300042601 | Bacteria | 1854 |
| 88 | Ga0466722_087561 | 3300042609 | Bacteria | 5812 |
| 89 | JGI24705J35276_12237100 | 3300002504 | Bacteria | 9812 |
| 90 | Ga0072941_1199762 | 3300005201 | Bacteria | 3648 |
| 91 | Ga0466711_243771 | 3300042615 | Bacteria | 56406 |
| 92 | Ga0466723_260285 | 3300042618 | Unclassified | 28868 |
| 93 | Ga0123357_10061715 | 3300009784 | Bacteria | 5022 |
| 94 | Ga0123353_10039098 | 3300010167 | Bacteria | 7463 |
| 95 | Ga0123354_10056657 | 3300010882 | Bacteria | 5849 |
| 96 | Ga0466656_139447 | 3300042550 | Bacteria | 1480 |
| 97 | Ga0466657_143514 | 3300042582 | Bacteria | 5819 |
| 98 | Ga0466690_254197 | 3300042590 | Bacteria | 12562 |
| 99 | Ga0466703_129960 | 3300042636 | Bacteria | 66694 |
| 100 | Ga0466709_091474 | 3300042648 | Unclassified | 13372 |
| 101 | Ga0466709_095769 | 3300042648 | Bacteria | 6836 |
| 102 | Ga0466733_084358 | 3300042659 | Bacteria | 46146 |
| 103 | Ga0466706_114421 | 3300042599 | Unclassified | 2281 |
| 104 | Ga0466707_160239 | 3300042601 | Bacteria | 3395 |
| 105 | Ga0466722_041895 | 3300042609 | Bacteria | 4914 |
| 106 | JGI24702J35022_10043642 | 3300002462 | Bacteria | 2388 |
| 107 | JGI24702J35022_10048138 | 3300002462 | Bacteria | 2269 |
| 108 | Ga0466710_144342 | 3300042613 | Bacteria | 61511 |
| 109 | Ga0466715_279493 | 3300042616 | Bacteria | 9203 |
| 110 | Ga0466729_090397 | 3300042621 | Bacteria | 10191 |
| 111 | Ga0466690_252595 | 3300042590 | Bacteria | 114158 |
| 112 | Ga0466691_176448 | 3300042593 | Bacteria | 4199 |
| 113 | Ga0466694_361991 | 3300042594 | Bacteria | 1596 |
| 114 | Ga0466696_017729 | 3300042596 | Bacteria | 17063 |
| 115 | Ga0466696_079422 | 3300042596 | Bacteria | 3668 |
| 116 | Ga0466729_293695 | 3300042621 | Bacteria | 1658 |
| 117 | Ga0466734_008859 | 3300042623 | Bacteria | 4257 |
| 118 | Ga0466704_496553 | 3300042643 | Bacteria | 2415 |
| 119 | Ga0466708_160447 | 3300042652 | Bacteria | 16224 |
| 120 | Ga0466708_320174 | 3300042652 | Bacteria | 10628 |
| 121 | Ga0466727_045757 | 3300042655 | Bacteria | 39456 |
| 122 | Ga0466705_275699 | 3300042612 | Bacteria | 5491 |
| 123 | Ga0466705_291286 | 3300042612 | Bacteria | 34997 |
| 124 | Ga0466706_047989 | 3300042599 | Bacteria | 4741 |
| 125 | Ga0466700_338689 | 3300042600 | Bacteria | 6023 |
| 126 | Ga0466707_139530 | 3300042601 | Bacteria | 6430 |
| 127 | Ga0466713_075329 | 3300042602 | Bacteria | 69428 |
| 128 | Ga0466716_337653 | 3300042605 | Bacteria | 4641 |
| 129 | Ga0466723_136992 | 3300042618 | Bacteria | 12657 |
| 130 | Ga0466723_216336 | 3300042618 | Bacteria | 1671 |
| 131 | Ga0466726_462797 | 3300042619 | Bacteria | 11323 |
| 132 | Ga0466729_135466 | 3300042621 | Bacteria | 44776 |
| 133 | Ga0123356_10111917 | 3300010049 | Bacteria | 2639 |
| 134 | Ga0123353_10009210 | 3300010167 | Bacteria | 13590 |
| 135 | Ga0123353_10317739 | 3300010167 | Bacteria | 2365 |
| 136 | Ga0123353_10666034 | 3300010167 | Bacteria | 1469 |
| 137 | Ga0466657_015987 | 3300042582 | Bacteria | 12122 |
| 138 | Ga0466657_401865 | 3300042582 | Bacteria | 115966 |
| 139 | Ga0466692_128210 | 3300042591 | Bacteria | 14398 |
| 140 | Ga0466692_173863 | 3300042591 | Bacteria | 18477 |
| 141 | Ga0466691_026950 | 3300042593 | Bacteria | 2964 |
| 142 | Ga0466702_106105 | 3300042635 | Bacteria | 9220 |
| 143 | Ga0466704_011548 | 3300042643 | Bacteria | 11039 |
| 144 | Ga0466704_253513 | 3300042643 | Bacteria | 1440 |
| 145 | Ga0466704_350064 | 3300042643 | Bacteria | 25347 |
| 146 | Ga0466704_491869 | 3300042643 | Unclassified | 8447 |
| 147 | Ga0466708_029826 | 3300042652 | Bacteria | 6505 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.