Protein Family IF05677

Metagenome Isolate
143 Members
88 Samples
101 Scaffolds
167.04 Avg Length

🧬 Representative Sequence

ID
3300042599|Ga0466706_226472|Ga0466706_226472_292_888
Length
198 aa
Sequence
MLTFASIFNKFSPQNYIKSESLLPLRLIKIHIDMAITHFQGTEVKTSGTLPAVGAQAPNFTLVKSDLSALSLSDLKGKQVVLNIFPSIDTGVCAASVRRFNKEAATLAGAVVLCISKDLPFAQARFCGAEGLNNVVTLSDFRTADFANHYGVLQQDGPLAGLLARAVVVIDAAGKVKYSQLVSEITHEPDYEAALAAL

📊 Sample Types

Isolate 29.4%
Metagenome 70.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 30.6%
Termitidae 15.3%
Tenebrionidae 9.4%
Kalotermitidae 8.2%
Elmidae 7.1%
Culicidae 7.1%
Drosophilidae 3.5%
Formicidae 3.5%
Rhinotermitidae 2.4%
Armadillidiidae 2.4%
Termopsidae 2.4%
Hydrophilidae 1.2%
Passalidae 1.2%
Hodotermitidae 1.2%
Bombycidae 1.2%
Cambaridae 1.2%
Apidae 1.2%
Nephropidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 133
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
2 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
3 2820929059 Unclassified Actinobacteria Emb289P3bin110 Isolate Unclassified
4 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
5 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
6 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
7 2931425734 Nocardioides sp. J2M5 Isolate
8 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
9 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
12 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
13 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
14 2904728850 Flavobacterium sp. xlx-214 Isolate
15 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
16 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
17 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
18 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
19 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
23 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
24 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
25 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
26 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
29 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
30 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
31 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
32 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
33 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
34 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
35 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
36 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
37 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
38 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
39 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
40 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
41 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
42 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
43 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
44 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
45 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
46 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
47 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
48 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
49 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
50 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
51 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
52 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
53 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
54 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
55 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
56 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
57 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
58 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
59 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
60 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
61 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
62 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
63 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
64 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
65 2600255079 Bifidobacterium bombi DSM 19703 Isolate Apidae
66 2820101058 Unclassified Proteobacteria Emb289P4bin76 Isolate Unclassified
67 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
68 2888667245 Corynebacterium diphtheriae FRC0190 Isolate Unclassified
69 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
70 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
71 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
72 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
73 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
74 2791355473 Vibrio barjaei 3062 Isolate Unclassified
75 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
76 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
77 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
78 3006242587 Vibrio sp. RE86 Isolate Unclassified
79 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
80 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
81 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
82 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
83 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
84 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
85 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
86 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
87 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
88 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0066 3300056790 Bacteria 440869
2 Ga0562379_1039 3300056790 Bacteria 38074
3 Ga0466707_388089 3300042601 Bacteria 4149
4 Ga0466724_09284 3300042649 Bacteria 258546
5 Ga0466724_10389 3300042649 Bacteria 45795
6 Ga0466724_27125 3300042649 Bacteria 132200
7 Ga0466708_282167 3300042652 Bacteria 9301
8 Ga0466727_073096 3300042655 Bacteria 5704
9 Ga0068305_10173155 3300005083 Unclassified 1959
10 Ga0562379_0589 3300056790 Bacteria 66171
11 Ga0562379_1569 3300056790 Bacteria 25020
12 Ga0562378_0680 3300056814 Bacteria 49864
13 Ga0562376_0013 3300056857 Bacteria 733279
14 Ga0466700_202355 3300042600 Bacteria 2307
15 Ga0466713_065581 3300042602 Bacteria 52137
16 Ga0466704_558121 3300042643 Bacteria 1179
17 Ga0466708_193832 3300042652 Bacteria 7211
18 Ga0466727_075887 3300042655 Bacteria 14934
19 Ga0466727_324657 3300042655 Bacteria 25319
20 Ga0160470_100012 3300012813 Bacteria 373404
21 Ga0068305_10844136 3300005083 Unclassified 794
22 Ga0103261_1006430 3300007083 Bacteria 1705
23 Ga0104048_1002343 3300007143 Unclassified 3140
24 Ga0104050_1005356 3300007153 Bacteria 10776
25 Ga0530661_001065 3300056564 Bacteria 15771
26 Ga0562378_0341 3300056814 Bacteria 91004
27 Ga0562378_1664 3300056814 Unclassified 22791
28 Ga0562374_0768 3300057007 Bacteria 46501
29 Ga0466706_106428 3300042599 Bacteria 2062
30 Ga0466706_226472 3300042599 Bacteria 2480
31 Ga0466713_085517 3300042602 Bacteria 4751
32 Ga0466713_123258 3300042602 Bacteria 55709
33 Ga0466704_269443 3300042643 Bacteria 3521
34 Ga0466727_298400 3300042655 Bacteria 5899
35 Ga0123357_10162047 3300009784 Bacteria 2677
36 Ga0123356_10020826 3300010049 Bacteria 6202
37 JGI24702J35022_10092381 3300002462 Bacteria 1648
38 Ga0562377_0064 3300056842 Bacteria 457777
39 Ga0562375_0623 3300056856 Unclassified 66838
40 Ga0562376_0047 3300056857 Bacteria 307693
41 Ga0466713_068004 3300042602 Bacteria 5104
42 Ga0466713_099099 3300042602 Bacteria 5989
43 Ga0466730_054806 3300042625 Bacteria 801523
44 Ga0466727_235056 3300042655 Bacteria 3957
45 Ga0160458_100038 3300012832 Bacteria 185944
46 Ga0466701_014350 3300042598 Bacteria 68002
47 Ga0562378_0783 3300056814 Unclassified 43780
48 Ga0562376_1969 3300056857 Unclassified 26674
49 Ga0466706_153926 3300042599 Bacteria 20845
50 Ga0466706_265143 3300042599 Bacteria 31444
51 Ga0466715_377145 3300042616 Bacteria 1874
52 Ga0466726_460030 3300042619 Bacteria 9201
53 Ga0103263_110404 3300007042 Bacteria 952
54 Ga0104050_1001037 3300007153 Bacteria 5063
55 Ga0160443_101490 3300012848 Unclassified 7722
56 Ga0466657_386076 3300042582 Bacteria 4593
57 Ga0466692_099698 3300042591 Bacteria 1389
58 Ga0466705_009364 3300042612 Bacteria 2029
59 Ga0562375_0001 3300056856 Bacteria 3661630
60 Ga0562375_0026 3300056856 Bacteria 725899
61 Ga0466719_532993 3300042606 Bacteria 2574
62 Ga0466698_342286 3300042610 Bacteria 2066
63 Ga0466715_068634 3300042616 Bacteria 15808
64 Ga0466730_021757 3300042625 Bacteria 584842
65 Ga0466708_182369 3300042652 Bacteria 2792
66 Ga0466708_298806 3300042652 Bacteria 30247
67 Ga0123353_10374328 3300010167 Bacteria 2133
68 Ga0123353_11482745 3300010167 Bacteria 865
69 IMNBGM34_c000009 3300000036 Bacteria 55175
70 JGI24705J35276_12174540 3300002504 Bacteria 1318
71 CVPL005L_10002799 3300002938 Bacteria 19810
72 Ga0123357_10000004 3300009784 Bacteria 308216
73 Ga0466701_009529 3300042598 Bacteria 375690
74 Ga0466733_072342 3300042659 Bacteria 18235
75 Ga0562377_0009 3300056842 Bacteria 1580355
76 Ga0562375_0950 3300056856 Bacteria 46257
77 Ga0562376_1165 3300056857 Bacteria 38778
78 Ga0562376_3820 3300056857 Unclassified 14241
79 Ga0466701_035038 3300042598 Bacteria 14108
80 Ga0466701_070278 3300042598 Bacteria 16896
81 Ga0466715_558707 3300042616 Unclassified 1541
82 Ga0466729_285413 3300042621 Bacteria 7321
83 Ga0466724_09429 3300042649 Bacteria 389876
84 Ga0123356_10000783 3300010049 Bacteria 35212
85 Ga0123353_10007576 3300010167 Bacteria 14709
86 Ga0103261_1001667 3300007083 Bacteria 3545
87 Ga0160443_100006 3300012848 Bacteria 647325
88 Ga0562377_1369 3300056842 Bacteria 25963
89 Ga0562376_4072 3300056857 Bacteria 13173
90 Ga0466701_046051 3300042598 Bacteria 26733
91 Ga0466713_085462 3300042602 Bacteria 2811
92 Ga0466713_145073 3300042602 Bacteria 14313
93 Ga0466715_031980 3300042616 Bacteria 5409
94 Ga0466715_471823 3300042616 Bacteria 8826
95 Ga0466726_076089 3300042619 Bacteria 25678
96 Ga0466703_371370 3300042636 Bacteria 5830
97 Ga0123354_10000063 3300010882 Bacteria 79556
98 Ga0104045_1023622 3300007085 Bacteria 4847
99 Ga0104045_1087002 3300007085 Bacteria 815
100 Ga0160445_100402 3300012847 Bacteria 23842
101 Ga0466696_354605 3300042596 Bacteria 8905

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00578 AhpC-TSA AhpC/TSA family 53 178 0.97
PF08534 Redoxin Redoxin 53 195 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF08534 GO:0016491 oxidoreductase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.