Protein Family IF05677
Metagenome
Isolate
143
Members
88
Samples
101
Scaffolds
167.04
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_226472|Ga0466706_226472_292_888
- Length
- 198 aa
- Sequence
- MLTFASIFNKFSPQNYIKSESLLPLRLIKIHIDMAITHFQGTEVKTSGTLPAVGAQAPNFTLVKSDLSALSLSDLKGKQVVLNIFPSIDTGVCAASVRRFNKEAATLAGAVVLCISKDLPFAQARFCGAEGLNNVVTLSDFRTADFANHYGVLQQDGPLAGLLARAVVVIDAAGKVKYSQLVSEITHEPDYEAALAAL
Sample Types
Isolate
29.4%
Metagenome
70.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
30.6%
Termitidae
15.3%
Tenebrionidae
9.4%
Kalotermitidae
8.2%
Elmidae
7.1%
Culicidae
7.1%
Drosophilidae
3.5%
Formicidae
3.5%
Rhinotermitidae
2.4%
Armadillidiidae
2.4%
Termopsidae
2.4%
Hydrophilidae
1.2%
Passalidae
1.2%
Hodotermitidae
1.2%
Bombycidae
1.2%
Cambaridae
1.2%
Apidae
1.2%
Nephropidae
1.2%
Taxonomy
Archaea
0
Bacteria
133
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 2 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 3 | 2820929059 | Unclassified Actinobacteria Emb289P3bin110 | Isolate | Unclassified |
| 4 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 5 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 6 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 7 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 8 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 9 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 12 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 13 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 14 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 15 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 19 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 23 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 24 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 25 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 29 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 32 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 33 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 34 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 35 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 36 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 37 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 38 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 42 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 43 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 44 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 45 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 46 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 47 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 48 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 49 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 50 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 51 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 52 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 53 | 2820829137 | Unclassified Actinobacteria Nc150P5bin2 | Isolate | Unclassified |
| 54 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 55 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 56 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 57 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 58 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 59 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 60 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 61 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 62 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 63 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 64 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 65 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 66 | 2820101058 | Unclassified Proteobacteria Emb289P4bin76 | Isolate | Unclassified |
| 67 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 68 | 2888667245 | Corynebacterium diphtheriae FRC0190 | Isolate | Unclassified |
| 69 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 70 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 71 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 72 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 73 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 74 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 75 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 76 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 77 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 78 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 79 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 80 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 81 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 82 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 83 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 84 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 85 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 86 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 87 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 88 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562379_0066 | 3300056790 | Bacteria | 440869 |
| 2 | Ga0562379_1039 | 3300056790 | Bacteria | 38074 |
| 3 | Ga0466707_388089 | 3300042601 | Bacteria | 4149 |
| 4 | Ga0466724_09284 | 3300042649 | Bacteria | 258546 |
| 5 | Ga0466724_10389 | 3300042649 | Bacteria | 45795 |
| 6 | Ga0466724_27125 | 3300042649 | Bacteria | 132200 |
| 7 | Ga0466708_282167 | 3300042652 | Bacteria | 9301 |
| 8 | Ga0466727_073096 | 3300042655 | Bacteria | 5704 |
| 9 | Ga0068305_10173155 | 3300005083 | Unclassified | 1959 |
| 10 | Ga0562379_0589 | 3300056790 | Bacteria | 66171 |
| 11 | Ga0562379_1569 | 3300056790 | Bacteria | 25020 |
| 12 | Ga0562378_0680 | 3300056814 | Bacteria | 49864 |
| 13 | Ga0562376_0013 | 3300056857 | Bacteria | 733279 |
| 14 | Ga0466700_202355 | 3300042600 | Bacteria | 2307 |
| 15 | Ga0466713_065581 | 3300042602 | Bacteria | 52137 |
| 16 | Ga0466704_558121 | 3300042643 | Bacteria | 1179 |
| 17 | Ga0466708_193832 | 3300042652 | Bacteria | 7211 |
| 18 | Ga0466727_075887 | 3300042655 | Bacteria | 14934 |
| 19 | Ga0466727_324657 | 3300042655 | Bacteria | 25319 |
| 20 | Ga0160470_100012 | 3300012813 | Bacteria | 373404 |
| 21 | Ga0068305_10844136 | 3300005083 | Unclassified | 794 |
| 22 | Ga0103261_1006430 | 3300007083 | Bacteria | 1705 |
| 23 | Ga0104048_1002343 | 3300007143 | Unclassified | 3140 |
| 24 | Ga0104050_1005356 | 3300007153 | Bacteria | 10776 |
| 25 | Ga0530661_001065 | 3300056564 | Bacteria | 15771 |
| 26 | Ga0562378_0341 | 3300056814 | Bacteria | 91004 |
| 27 | Ga0562378_1664 | 3300056814 | Unclassified | 22791 |
| 28 | Ga0562374_0768 | 3300057007 | Bacteria | 46501 |
| 29 | Ga0466706_106428 | 3300042599 | Bacteria | 2062 |
| 30 | Ga0466706_226472 | 3300042599 | Bacteria | 2480 |
| 31 | Ga0466713_085517 | 3300042602 | Bacteria | 4751 |
| 32 | Ga0466713_123258 | 3300042602 | Bacteria | 55709 |
| 33 | Ga0466704_269443 | 3300042643 | Bacteria | 3521 |
| 34 | Ga0466727_298400 | 3300042655 | Bacteria | 5899 |
| 35 | Ga0123357_10162047 | 3300009784 | Bacteria | 2677 |
| 36 | Ga0123356_10020826 | 3300010049 | Bacteria | 6202 |
| 37 | JGI24702J35022_10092381 | 3300002462 | Bacteria | 1648 |
| 38 | Ga0562377_0064 | 3300056842 | Bacteria | 457777 |
| 39 | Ga0562375_0623 | 3300056856 | Unclassified | 66838 |
| 40 | Ga0562376_0047 | 3300056857 | Bacteria | 307693 |
| 41 | Ga0466713_068004 | 3300042602 | Bacteria | 5104 |
| 42 | Ga0466713_099099 | 3300042602 | Bacteria | 5989 |
| 43 | Ga0466730_054806 | 3300042625 | Bacteria | 801523 |
| 44 | Ga0466727_235056 | 3300042655 | Bacteria | 3957 |
| 45 | Ga0160458_100038 | 3300012832 | Bacteria | 185944 |
| 46 | Ga0466701_014350 | 3300042598 | Bacteria | 68002 |
| 47 | Ga0562378_0783 | 3300056814 | Unclassified | 43780 |
| 48 | Ga0562376_1969 | 3300056857 | Unclassified | 26674 |
| 49 | Ga0466706_153926 | 3300042599 | Bacteria | 20845 |
| 50 | Ga0466706_265143 | 3300042599 | Bacteria | 31444 |
| 51 | Ga0466715_377145 | 3300042616 | Bacteria | 1874 |
| 52 | Ga0466726_460030 | 3300042619 | Bacteria | 9201 |
| 53 | Ga0103263_110404 | 3300007042 | Bacteria | 952 |
| 54 | Ga0104050_1001037 | 3300007153 | Bacteria | 5063 |
| 55 | Ga0160443_101490 | 3300012848 | Unclassified | 7722 |
| 56 | Ga0466657_386076 | 3300042582 | Bacteria | 4593 |
| 57 | Ga0466692_099698 | 3300042591 | Bacteria | 1389 |
| 58 | Ga0466705_009364 | 3300042612 | Bacteria | 2029 |
| 59 | Ga0562375_0001 | 3300056856 | Bacteria | 3661630 |
| 60 | Ga0562375_0026 | 3300056856 | Bacteria | 725899 |
| 61 | Ga0466719_532993 | 3300042606 | Bacteria | 2574 |
| 62 | Ga0466698_342286 | 3300042610 | Bacteria | 2066 |
| 63 | Ga0466715_068634 | 3300042616 | Bacteria | 15808 |
| 64 | Ga0466730_021757 | 3300042625 | Bacteria | 584842 |
| 65 | Ga0466708_182369 | 3300042652 | Bacteria | 2792 |
| 66 | Ga0466708_298806 | 3300042652 | Bacteria | 30247 |
| 67 | Ga0123353_10374328 | 3300010167 | Bacteria | 2133 |
| 68 | Ga0123353_11482745 | 3300010167 | Bacteria | 865 |
| 69 | IMNBGM34_c000009 | 3300000036 | Bacteria | 55175 |
| 70 | JGI24705J35276_12174540 | 3300002504 | Bacteria | 1318 |
| 71 | CVPL005L_10002799 | 3300002938 | Bacteria | 19810 |
| 72 | Ga0123357_10000004 | 3300009784 | Bacteria | 308216 |
| 73 | Ga0466701_009529 | 3300042598 | Bacteria | 375690 |
| 74 | Ga0466733_072342 | 3300042659 | Bacteria | 18235 |
| 75 | Ga0562377_0009 | 3300056842 | Bacteria | 1580355 |
| 76 | Ga0562375_0950 | 3300056856 | Bacteria | 46257 |
| 77 | Ga0562376_1165 | 3300056857 | Bacteria | 38778 |
| 78 | Ga0562376_3820 | 3300056857 | Unclassified | 14241 |
| 79 | Ga0466701_035038 | 3300042598 | Bacteria | 14108 |
| 80 | Ga0466701_070278 | 3300042598 | Bacteria | 16896 |
| 81 | Ga0466715_558707 | 3300042616 | Unclassified | 1541 |
| 82 | Ga0466729_285413 | 3300042621 | Bacteria | 7321 |
| 83 | Ga0466724_09429 | 3300042649 | Bacteria | 389876 |
| 84 | Ga0123356_10000783 | 3300010049 | Bacteria | 35212 |
| 85 | Ga0123353_10007576 | 3300010167 | Bacteria | 14709 |
| 86 | Ga0103261_1001667 | 3300007083 | Bacteria | 3545 |
| 87 | Ga0160443_100006 | 3300012848 | Bacteria | 647325 |
| 88 | Ga0562377_1369 | 3300056842 | Bacteria | 25963 |
| 89 | Ga0562376_4072 | 3300056857 | Bacteria | 13173 |
| 90 | Ga0466701_046051 | 3300042598 | Bacteria | 26733 |
| 91 | Ga0466713_085462 | 3300042602 | Bacteria | 2811 |
| 92 | Ga0466713_145073 | 3300042602 | Bacteria | 14313 |
| 93 | Ga0466715_031980 | 3300042616 | Bacteria | 5409 |
| 94 | Ga0466715_471823 | 3300042616 | Bacteria | 8826 |
| 95 | Ga0466726_076089 | 3300042619 | Bacteria | 25678 |
| 96 | Ga0466703_371370 | 3300042636 | Bacteria | 5830 |
| 97 | Ga0123354_10000063 | 3300010882 | Bacteria | 79556 |
| 98 | Ga0104045_1023622 | 3300007085 | Bacteria | 4847 |
| 99 | Ga0104045_1087002 | 3300007085 | Bacteria | 815 |
| 100 | Ga0160445_100402 | 3300012847 | Bacteria | 23842 |
| 101 | Ga0466696_354605 | 3300042596 | Bacteria | 8905 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF08534 | GO:0016491 | oxidoreductase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.