Protein Family IF05668
Metagenome
Isolate
167
Members
49
Samples
161
Scaffolds
127.32
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_210781|Ga0466706_210781_441_851
- Length
- 136 aa
- Sequence
- VTGGTISRPSVETVIAIHDRLIAQIGGLDGLRDANLLDMSVNAPFQTFDGIDLYPNLIDKASHLAYSLIKNHAFLDGNKRVGVTVLLVFLKANGIQVECTNAELTALGLGIADGTVDEAGIKKWLACHIQVLGYRL
Sample Types
Isolate
3.6%
Metagenome
96.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
61.7%
Unclassified
14.9%
Kalotermitidae
8.5%
Termopsidae
8.5%
Rhinotermitidae
2.1%
Hodotermitidae
2.1%
Passalidae
2.1%
Taxonomy
Archaea
2
Bacteria
153
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 8 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 19 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 20 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 23 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 24 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 25 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 26 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 27 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 31 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 32 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 33 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 34 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 35 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 36 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 42 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 43 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 44 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 45 | 2820014844 | Unclassified Spirochaetes Nt197P3bin95 | Isolate | Unclassified |
| 46 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 47 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_401563 | 3300042612 | Bacteria | 1929 |
| 2 | Ga0466718_089031 | 3300042617 | Unclassified | 1512 |
| 3 | Ga0466726_163508 | 3300042619 | Bacteria | 2422 |
| 4 | Ga0466726_318939 | 3300042619 | Archaea | 2228 |
| 5 | Ga0123356_10164703 | 3300010049 | Bacteria | 2220 |
| 6 | Ga0123356_11132439 | 3300010049 | Bacteria | 950 |
| 7 | Ga0123356_11134455 | 3300010049 | Bacteria | 949 |
| 8 | Ga0123353_10741072 | 3300010167 | Bacteria | 1369 |
| 9 | Ga0264413_135302 | 3300024493 | Bacteria | 3494 |
| 10 | Ga0466694_014848 | 3300042594 | Bacteria | 1237 |
| 11 | Ga0466694_021019 | 3300042594 | Bacteria | 2512 |
| 12 | Ga0466694_264889 | 3300042594 | Bacteria | 1229 |
| 13 | Ga0466706_247842 | 3300042599 | Bacteria | 2322 |
| 14 | Ga0466714_131501 | 3300042603 | Bacteria | 2059 |
| 15 | 2227479066 | 2225789004 | Bacteria | 4517 |
| 16 | AustNasuHG_c1059870 | 3300000089 | Bacteria | 744 |
| 17 | JGI24698J34947_10045762 | 3300002449 | Unclassified | 2231 |
| 18 | JGI24698J34947_10252216 | 3300002449 | Bacteria | 658 |
| 19 | JGI24695J34938_10006968 | 3300002450 | Bacteria | 6705 |
| 20 | JGI24695J34938_10356492 | 3300002450 | Bacteria | 644 |
| 21 | Ga0072940_1180568 | 3300005200 | Bacteria | 1125 |
| 22 | Ga0072941_1124855 | 3300005201 | Bacteria | 2653 |
| 23 | Ga0466731_156050 | 3300042622 | Bacteria | 2058 |
| 24 | Ga0466702_048951 | 3300042635 | Bacteria | 2691 |
| 25 | Ga0466702_360921 | 3300042635 | Unclassified | 2103 |
| 26 | Ga0466724_50518 | 3300042649 | Bacteria | 2143 |
| 27 | Ga0466732_292301 | 3300042656 | Bacteria | 5025 |
| 28 | Ga0123356_10162329 | 3300010049 | Bacteria | 2234 |
| 29 | Ga0123356_10213590 | 3300010049 | Bacteria | 1980 |
| 30 | Ga0123356_10422763 | 3300010049 | Bacteria | 1475 |
| 31 | Ga0123356_10751533 | 3300010049 | Bacteria | 1145 |
| 32 | Ga0123356_13079863 | 3300010049 | Bacteria | 581 |
| 33 | Ga0123356_13413323 | 3300010049 | Bacteria | 551 |
| 34 | Ga0123353_10999590 | 3300010167 | Bacteria | 1124 |
| 35 | Ga0415639_015670 | 3300038395 | Bacteria | 42553 |
| 36 | Ga0415639_046973 | 3300038395 | Bacteria | 1947 |
| 37 | Ga0415639_211014 | 3300038395 | Bacteria | 1923 |
| 38 | Ga0466699_033922 | 3300042597 | Bacteria | 12020 |
| 39 | Ga0466700_018105 | 3300042600 | Bacteria | 1520 |
| 40 | Ga0466707_165489 | 3300042601 | Bacteria | 3692 |
| 41 | Ga0466714_000825 | 3300042603 | Bacteria | 4904 |
| 42 | Nasutiter_Contig10637 | 2030936001 | Bacteria | 866 |
| 43 | JGI24695J34938_10000363 | 3300002450 | Bacteria | 44964 |
| 44 | JGI24695J34938_10036705 | 3300002450 | Bacteria | 2232 |
| 45 | JGI24695J34938_10098317 | 3300002450 | Bacteria | 1197 |
| 46 | JGI24695J34938_10331535 | 3300002450 | Bacteria | 664 |
| 47 | JGI24696J40584_12568093 | 3300002834 | Bacteria | 636 |
| 48 | Ga0068302_10228880 | 3300005071 | Bacteria | 891 |
| 49 | Ga0072941_1026119 | 3300005201 | Bacteria | 14152 |
| 50 | Ga0466735_039700 | 3300042624 | Bacteria | 1290 |
| 51 | Ga0466718_045232 | 3300042617 | Bacteria | 1889 |
| 52 | Ga0466726_383451 | 3300042619 | Bacteria | 3118 |
| 53 | Ga0123357_10234225 | 3300009784 | Bacteria | 2004 |
| 54 | Ga0123356_10326943 | 3300010049 | Bacteria | 1648 |
| 55 | Ga0123353_10393063 | 3300010167 | Bacteria | 2068 |
| 56 | Ga0415639_134762 | 3300038395 | Bacteria | 2092 |
| 57 | Ga0466695_266865 | 3300042595 | Bacteria | 2585 |
| 58 | Ga0466699_213976 | 3300042597 | Bacteria | 2805 |
| 59 | Ga0466717_067303 | 3300042604 | Bacteria | 1018 |
| 60 | Ga0466720_000069 | 3300042607 | Bacteria | 1703 |
| 61 | Ga0466720_019389 | 3300042607 | Bacteria | 3190 |
| 62 | JGI24698J34947_10208451 | 3300002449 | Bacteria | 759 |
| 63 | JGI24695J34938_10005574 | 3300002450 | Bacteria | 7806 |
| 64 | JGI24695J34938_10006167 | 3300002450 | Bacteria | 7290 |
| 65 | JGI24695J34938_10007529 | 3300002450 | Bacteria | 6357 |
| 66 | JGI24702J35022_10044688 | 3300002462 | Bacteria | 2360 |
| 67 | Ga0466731_104955 | 3300042622 | Bacteria | 1019 |
| 68 | Ga0466702_232967 | 3300042635 | Bacteria | 3136 |
| 69 | Ga0466732_033639 | 3300042656 | Unclassified | 1178 |
| 70 | Ga0466726_075711 | 3300042619 | Bacteria | 1249 |
| 71 | Ga0123356_10013536 | 3300010049 | Bacteria | 7869 |
| 72 | Ga0123356_10064958 | 3300010049 | Bacteria | 3413 |
| 73 | Ga0123356_10141257 | 3300010049 | Bacteria | 2376 |
| 74 | Ga0123356_10301765 | 3300010049 | Bacteria | 1707 |
| 75 | Ga0123353_10534587 | 3300010167 | Bacteria | 1696 |
| 76 | Ga0123353_10540363 | 3300010167 | Bacteria | 1684 |
| 77 | Ga0123353_10938492 | 3300010167 | Bacteria | 1172 |
| 78 | Ga0415639_046656 | 3300038395 | Bacteria | 3387 |
| 79 | Ga0466699_138496 | 3300042597 | Bacteria | 1513 |
| 80 | Ga0466699_207169 | 3300042597 | Bacteria | 1276 |
| 81 | Ga0466717_235680 | 3300042604 | Archaea | 1388 |
| 82 | Ga0466720_162042 | 3300042607 | Bacteria | 3262 |
| 83 | Ga0466698_242662 | 3300042610 | Bacteria | 6465 |
| 84 | JGI24703J35330_11748786 | 3300002501 | Bacteria | 36172 |
| 85 | Ga0466702_439653 | 3300042635 | Bacteria | 1398 |
| 86 | Ga0466704_016114 | 3300042643 | Bacteria | 2507 |
| 87 | Ga0466712_308149 | 3300042614 | Unclassified | 1297 |
| 88 | Ga0466718_024203 | 3300042617 | Bacteria | 1539 |
| 89 | Ga0466718_100672 | 3300042617 | Bacteria | 3060 |
| 90 | Ga0123356_10116304 | 3300010049 | Bacteria | 2593 |
| 91 | Ga0123356_10200504 | 3300010049 | Unclassified | 2035 |
| 92 | Ga0123356_10367160 | 3300010049 | Bacteria | 1568 |
| 93 | Ga0123356_10399141 | 3300010049 | Bacteria | 1512 |
| 94 | Ga0123356_10809711 | 3300010049 | Bacteria | 1108 |
| 95 | Ga0123356_12187543 | 3300010049 | Bacteria | 691 |
| 96 | Ga0123353_10612581 | 3300010167 | Bacteria | 1553 |
| 97 | Ga0123353_11241051 | 3300010167 | Bacteria | 974 |
| 98 | Ga0123353_12404915 | 3300010167 | Bacteria | 630 |
| 99 | Ga0466656_256033 | 3300042550 | Bacteria | 1898 |
| 100 | Ga0466694_072831 | 3300042594 | Bacteria | 1077 |
| 101 | Ga0466694_185506 | 3300042594 | Bacteria | 2300 |
| 102 | Ga0466699_352171 | 3300042597 | Bacteria | 1841 |
| 103 | Ga0466707_051242 | 3300042601 | Bacteria | 1804 |
| 104 | Ga0466720_231533 | 3300042607 | Bacteria | 14015 |
| 105 | Ga0466697_002647 | 3300042611 | Bacteria | 1965 |
| 106 | JGI24698J34947_10073901 | 3300002449 | Unclassified | 1625 |
| 107 | Ga0072940_1064487 | 3300005200 | Bacteria | 3959 |
| 108 | Ga0072941_1004065 | 3300005201 | Bacteria | 16772 |
| 109 | Ga0072941_1039449 | 3300005201 | Bacteria | 4023 |
| 110 | Ga0466718_060829 | 3300042617 | Bacteria | 1266 |
| 111 | Ga0123356_10525921 | 3300010049 | Bacteria | 1341 |
| 112 | Ga0123356_11317808 | 3300010049 | Bacteria | 885 |
| 113 | Ga0123353_11206373 | 3300010167 | Bacteria | 992 |
| 114 | Ga0123353_11830487 | 3300010167 | Bacteria | 753 |
| 115 | Ga0415639_087310 | 3300038395 | Unclassified | 1405 |
| 116 | Ga0415639_198732 | 3300038395 | Bacteria | 1089 |
| 117 | Ga0466699_063463 | 3300042597 | Bacteria | 1955 |
| 118 | Ga0466699_187648 | 3300042597 | Unclassified | 2615 |
| 119 | Ga0466719_273680 | 3300042606 | Bacteria | 1514 |
| 120 | Ga0466720_038676 | 3300042607 | Bacteria | 20239 |
| 121 | JGI24698J34947_10160450 | 3300002449 | Bacteria | 922 |
| 122 | JGI24698J34947_10261136 | 3300002449 | Bacteria | 642 |
| 123 | Ga0466731_088016 | 3300042622 | Bacteria | 1914 |
| 124 | Ga0466703_236863 | 3300042636 | Bacteria | 1172 |
| 125 | Ga0466727_165175 | 3300042655 | Bacteria | 2208 |
| 126 | Ga0466712_247290 | 3300042614 | Unclassified | 3315 |
| 127 | Ga0466726_283813 | 3300042619 | Bacteria | 1154 |
| 128 | Ga0466729_134475 | 3300042621 | Bacteria | 2272 |
| 129 | Ga0123356_10044261 | 3300010049 | Bacteria | 4144 |
| 130 | Ga0123356_10296893 | 3300010049 | Bacteria | 1719 |
| 131 | Ga0123356_10509600 | 3300010049 | Bacteria | 1360 |
| 132 | Ga0123356_13633775 | 3300010049 | Bacteria | 534 |
| 133 | Ga0123353_11226412 | 3300010167 | Bacteria | 981 |
| 134 | Ga0415639_020304 | 3300038395 | Bacteria | 10871 |
| 135 | Ga0466695_187276 | 3300042595 | Unclassified | 2950 |
| 136 | Ga0466706_210781 | 3300042599 | Bacteria | 1305 |
| 137 | Ga0466700_250618 | 3300042600 | Bacteria | 1371 |
| 138 | Ga0466720_087186 | 3300042607 | Bacteria | 2834 |
| 139 | JGI24695J34938_10007773 | 3300002450 | Bacteria | 6214 |
| 140 | JGI24695J34938_10021364 | 3300002450 | Bacteria | 3168 |
| 141 | JGI24702J35022_10063210 | 3300002462 | Bacteria | 1983 |
| 142 | Ga0072940_1419017 | 3300005200 | Bacteria | 1036 |
| 143 | Ga0466718_074315 | 3300042617 | Bacteria | 22338 |
| 144 | Ga0466726_336214 | 3300042619 | Unclassified | 2603 |
| 145 | Ga0466726_411368 | 3300042619 | Bacteria | 1593 |
| 146 | Ga0466729_097150 | 3300042621 | Bacteria | 3392 |
| 147 | Ga0123355_11008466 | 3300009826 | Bacteria | 883 |
| 148 | Ga0123356_10030010 | 3300010049 | Bacteria | 5090 |
| 149 | Ga0123356_10054440 | 3300010049 | Bacteria | 3726 |
| 150 | Ga0123356_10223788 | 3300010049 | Bacteria | 1940 |
| 151 | Ga0123356_10619061 | 3300010049 | Bacteria | 1248 |
| 152 | Ga0123356_11086043 | 3300010049 | Bacteria | 969 |
| 153 | Ga0123353_10081461 | 3300010167 | Bacteria | 5205 |
| 154 | Ga0123353_10407562 | 3300010167 | Bacteria | 2020 |
| 155 | Ga0466707_009539 | 3300042601 | Bacteria | 6184 |
| 156 | Ga0466707_246938 | 3300042601 | Bacteria | 1239 |
| 157 | Ga0466720_143104 | 3300042607 | Bacteria | 24676 |
| 158 | Ga0466720_195704 | 3300042607 | Bacteria | 1112 |
| 159 | AustNasuHG_c1017868 | 3300000089 | Bacteria | 2349 |
| 160 | AustNasuHG_c1071243 | 3300000089 | Bacteria | 624 |
| 161 | JGI24695J34938_10064974 | 3300002450 | Bacteria | 1542 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02661 | Fic | Fic/DOC family | 10 | 90 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.