Protein Family IF05664
Metagenome
Metatranscriptome
Isolate
395
Members
165
Samples
290
Scaffolds
120.85
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_207116|Ga0466706_207116_3911_4345
- Length
- 144 aa
- Sequence
- MILPYKKIENQYGKSYWRKGNIYIMDKKILIVDDAAFMRMMVKDALHKSGFTNTIEAADGQIACDTYTKEKPDLVIMDITMPNKTGIEALEEIKKNDPSAKVVMCSAMGQEAMVIQAISLGALDFIVKPFKPDRIIQTVTKVLG
Sample Types
Isolate
26.6%
Metagenome
72.9%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
39.0%
Termitidae
18.9%
Blattidae
14.5%
Kalotermitidae
9.4%
Apidae
3.1%
Termopsidae
2.5%
Elmidae
1.9%
Scarabaeidae
1.9%
Rhinotermitidae
1.3%
Drosophilidae
1.3%
Passalidae
1.3%
Stratiomyidae
0.6%
Culicidae
0.6%
Penaeidae
0.6%
Noctuidae
0.6%
Calliphoridae
0.6%
Hodotermitidae
0.6%
Armadillidiidae
0.6%
Formicidae
0.6%
Taxonomy
Archaea
2
Bacteria
314
Eukaryota
0
Viruses
0
Unclassified
79
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 7 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 8 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 9 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 10 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 11 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 12 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 13 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 14 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 15 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 16 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 17 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 18 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 21 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 22 | 2820007728 | Unclassified Synergistetes Lab288P3bin114 | Isolate | Unclassified |
| 23 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 24 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 25 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 26 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 27 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 28 | 2820455747 | Unclassified Firmicutes Lab288P3bin160 | Isolate | Unclassified |
| 29 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 30 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 31 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 32 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 33 | 2820569216 | Unclassified Firmicutes Emb289P3bin33 | Isolate | Unclassified |
| 34 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 35 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 36 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 37 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 38 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 39 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 40 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 41 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 42 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 43 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 44 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 45 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 46 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 47 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 48 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 49 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 50 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 51 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 52 | 2820373881 | Unclassified Firmicutes Nt197P3bin10 | Isolate | Unclassified |
| 53 | 2820463629 | Unclassified Firmicutes Lab288P3bin124 | Isolate | Unclassified |
| 54 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 55 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 56 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 57 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 58 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 59 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 60 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 61 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 62 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 63 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 64 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 65 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 66 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 67 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 68 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 69 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 70 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 71 | 2820255904 | Unclassified Firmicutes Th196P3bin48 | Isolate | Unclassified |
| 72 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 73 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 74 | 2820360414 | Unclassified Firmicutes Nt197P3bin121 | Isolate | Unclassified |
| 75 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 76 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 77 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 78 | 3300021239 | Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA | Metatranscriptome | |
| 79 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 80 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 81 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 82 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 83 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 84 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 85 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 86 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 87 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 88 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 89 | 2820004052 | Unclassified Synergistetes Nt197P3bin25 | Isolate | Unclassified |
| 90 | 2820254385 | Unclassified Firmicutes Th196P3bin54 | Isolate | Unclassified |
| 91 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 92 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 93 | 2820339298 | Unclassified Firmicutes Nt197P3bin68 | Isolate | Unclassified |
| 94 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 95 | 2820709481 | Unclassified Firmicutes Co191P1bin30 | Isolate | Unclassified |
| 96 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 97 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 98 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 99 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 100 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 101 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 102 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 103 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 104 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 105 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 106 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 107 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 108 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 109 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 110 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 111 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 112 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 113 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 114 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 115 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 116 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 117 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 118 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 119 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 120 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 121 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 122 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 123 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 124 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 125 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 126 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 127 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 128 | 2820008971 | Unclassified Synergistetes Lab288P3bin103 | Isolate | Unclassified |
| 129 | 2820460928 | Unclassified Firmicutes Lab288P3bin140 | Isolate | Unclassified |
| 130 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 131 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 132 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 133 | 2820592308 | Unclassified Firmicutes Emb289P1bin71 | Isolate | Unclassified |
| 134 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 135 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 136 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 137 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 138 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 139 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 140 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 141 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 142 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 143 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 144 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 145 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 146 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 147 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 148 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 149 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 150 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 151 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 152 | 2820713307 | Unclassified Firmicutes Co191P1bin2 | Isolate | Unclassified |
| 153 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 154 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 155 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 156 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 157 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 158 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 159 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 160 | 3300038763 | Termite gut microbial communities of Labiotermes labralis from French Guiana - 62_rP2 | Metatranscriptome | Termitidae |
| 161 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 162 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 163 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 164 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 165 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_073993 | 3300042659 | Bacteria | 6210 |
| 2 | Ga0466733_170253 | 3300042659 | Unclassified | 5555 |
| 3 | FGTW_contig11830 | 2065487013 | Unclassified | 581 |
| 4 | 2212577970 | 2209111004 | Bacteria | 39599 |
| 5 | Ga0068305_10220899 | 3300005083 | Archaea | 1480 |
| 6 | Ga0072941_1123510 | 3300005201 | Bacteria | 1015 |
| 7 | Ga0466711_071397 | 3300042615 | Unclassified | 7244 |
| 8 | Ga0123355_10276458 | 3300009826 | Bacteria | 2325 |
| 9 | Ga0123356_10312053 | 3300010049 | Bacteria | 1682 |
| 10 | Ga0123356_10542043 | 3300010049 | Bacteria | 1324 |
| 11 | Ga0123356_11715252 | 3300010049 | Bacteria | 779 |
| 12 | Ga0123356_13891384 | 3300010049 | Unclassified | 515 |
| 13 | Ga0123353_10000063 | 3300010167 | Bacteria | 118144 |
| 14 | Ga0123353_10015196 | 3300010167 | Bacteria | 11164 |
| 15 | Ga0123353_10030662 | 3300010167 | Bacteria | 8314 |
| 16 | Ga0123353_10052188 | 3300010167 | Bacteria | 6527 |
| 17 | Ga0123353_10062974 | 3300010167 | Bacteria | 5948 |
| 18 | Ga0123353_10074450 | 3300010167 | Unclassified | 5459 |
| 19 | Ga0123353_10331712 | 3300010167 | Bacteria | 2302 |
| 20 | Ga0123353_10445472 | 3300010167 | Bacteria | 1909 |
| 21 | Ga0123353_11834924 | 3300010167 | Bacteria | 752 |
| 22 | Ga0123354_10338085 | 3300010882 | Bacteria | 1361 |
| 23 | Ga0160454_100018 | 3300012798 | Bacteria | 326271 |
| 24 | Ga0466702_265012 | 3300042635 | Bacteria | 98723 |
| 25 | Ga0466709_388414 | 3300042648 | Bacteria | 3372 |
| 26 | Ga0466708_110952 | 3300042652 | Unclassified | 13003 |
| 27 | Ga0466725_051445 | 3300042654 | Bacteria | 6468 |
| 28 | Ga0466706_003329 | 3300042599 | Bacteria | 6297 |
| 29 | Ga0466706_021938 | 3300042599 | Unclassified | 1856 |
| 30 | Ga0466706_058894 | 3300042599 | Bacteria | 3386 |
| 31 | Ga0466706_063946 | 3300042599 | Bacteria | 37826 |
| 32 | Ga0466706_174846 | 3300042599 | Unclassified | 1467 |
| 33 | Ga0466700_020542 | 3300042600 | Bacteria | 78614 |
| 34 | Ga0466700_044914 | 3300042600 | Bacteria | 2578 |
| 35 | Ga0466713_035622 | 3300042602 | Bacteria | 1034 |
| 36 | Ga0466714_067845 | 3300042603 | Bacteria | 28820 |
| 37 | Ga0466714_144279 | 3300042603 | Bacteria | 12677 |
| 38 | Ga0466722_120956 | 3300042609 | Bacteria | 26340 |
| 39 | Ga0160447_107188 | 3300012849 | Bacteria | 2824 |
| 40 | Ga0223677_1010230 | 3300021239 | Bacteria | 529 |
| 41 | Ga0415639_046498 | 3300038395 | Unclassified | 1159 |
| 42 | Ga0466696_067911 | 3300042596 | Unclassified | 1250 |
| 43 | Ga0466733_053289 | 3300042659 | Bacteria | 9342 |
| 44 | JGI24695J34938_10000375 | 3300002450 | Bacteria | 44352 |
| 45 | JGI24703J35330_11736971 | 3300002501 | Bacteria | 3074 |
| 46 | Ga0466715_044627 | 3300042616 | Unclassified | 16167 |
| 47 | Ga0466715_545398 | 3300042616 | Bacteria | 2062 |
| 48 | Ga0466726_113139 | 3300042619 | Bacteria | 24274 |
| 49 | Ga0123355_10206017 | 3300009826 | Bacteria | 2862 |
| 50 | Ga0123355_10365386 | 3300009826 | Bacteria | 1896 |
| 51 | Ga0123355_10567841 | 3300009826 | Bacteria | 1363 |
| 52 | Ga0123356_10112298 | 3300010049 | Unclassified | 2634 |
| 53 | Ga0123356_10593601 | 3300010049 | Bacteria | 1272 |
| 54 | Ga0123356_13149149 | 3300010049 | Bacteria | 575 |
| 55 | Ga0123353_10016758 | 3300010167 | Bacteria | 10726 |
| 56 | Ga0123353_10089074 | 3300010167 | Bacteria | 4969 |
| 57 | Ga0123353_10310398 | 3300010167 | Bacteria | 2401 |
| 58 | Ga0123353_10508794 | 3300010167 | Bacteria | 1752 |
| 59 | Ga0123354_10588095 | 3300010882 | Bacteria | 821 |
| 60 | Ga0466729_287045 | 3300042621 | Bacteria | 99069 |
| 61 | Ga0466702_322816 | 3300042635 | Bacteria | 2347 |
| 62 | Ga0466702_420015 | 3300042635 | Unclassified | 3724 |
| 63 | Ga0466702_427544 | 3300042635 | Unclassified | 1037 |
| 64 | Ga0466703_024308 | 3300042636 | Unclassified | 1121 |
| 65 | Ga0466704_291848 | 3300042643 | Unclassified | 5242 |
| 66 | Ga0466704_449192 | 3300042643 | Unclassified | 1099 |
| 67 | Ga0466709_303309 | 3300042648 | Unclassified | 1120 |
| 68 | Ga0466725_465874 | 3300042654 | Bacteria | 2463 |
| 69 | Ga0466706_018452 | 3300042599 | Bacteria | 54272 |
| 70 | Ga0466706_091489 | 3300042599 | Bacteria | 50051 |
| 71 | Ga0466706_122442 | 3300042599 | Bacteria | 110911 |
| 72 | Ga0466706_182332 | 3300042599 | Bacteria | 21381 |
| 73 | Ga0466706_275249 | 3300042599 | Bacteria | 4132 |
| 74 | Ga0466706_275946 | 3300042599 | Bacteria | 1613 |
| 75 | Ga0466707_220866 | 3300042601 | Bacteria | 1756 |
| 76 | Ga0466714_043633 | 3300042603 | Bacteria | 6677 |
| 77 | Ga0466714_071355 | 3300042603 | Bacteria | 9034 |
| 78 | Ga0466714_073203 | 3300042603 | Bacteria | 47226 |
| 79 | Ga0466717_011064 | 3300042604 | Bacteria | 4762 |
| 80 | Ga0466698_250460 | 3300042610 | Bacteria | 21504 |
| 81 | Ga0415639_001914 | 3300038395 | Bacteria | 21167 |
| 82 | Ga0415639_003783 | 3300038395 | Unclassified | 23996 |
| 83 | Ga0466693_361674 | 3300042592 | Unclassified | 3177 |
| 84 | Ga0466705_179225 | 3300042612 | Unclassified | 4278 |
| 85 | Ga0466733_115965 | 3300042659 | Bacteria | 1155 |
| 86 | IMNBL1DRAFT_c0017550 | 3300000062 | Bacteria | 3007 |
| 87 | JGI24700J35501_10910715 | 3300002508 | Bacteria | 3556 |
| 88 | Ga0068305_10091729 | 3300005083 | Bacteria | 3169 |
| 89 | Ga0072941_1581410 | 3300005201 | Bacteria | 685 |
| 90 | Ga0072941_1688877 | 3300005201 | Bacteria | 1054 |
| 91 | Ga0466711_035343 | 3300042615 | Unclassified | 3764 |
| 92 | Ga0466711_279812 | 3300042615 | Bacteria | 29450 |
| 93 | Ga0466711_435978 | 3300042615 | Unclassified | 8176 |
| 94 | Ga0466715_015092 | 3300042616 | Bacteria | 14269 |
| 95 | Ga0466715_322667 | 3300042616 | Bacteria | 38794 |
| 96 | Ga0466715_369850 | 3300042616 | Bacteria | 17122 |
| 97 | Ga0466726_079331 | 3300042619 | Bacteria | 50907 |
| 98 | Ga0123355_10040986 | 3300009826 | Bacteria | 7538 |
| 99 | Ga0123355_10048270 | 3300009826 | Bacteria | 6922 |
| 100 | Ga0123355_10423748 | 3300009826 | Bacteria | 1699 |
| 101 | Ga0123356_10000021 | 3300010049 | Bacteria | 176996 |
| 102 | Ga0123356_10685289 | 3300010049 | Unclassified | 1193 |
| 103 | Ga0123356_10896502 | 3300010049 | Bacteria | 1058 |
| 104 | Ga0123356_11012459 | 3300010049 | Bacteria | 1001 |
| 105 | Ga0123356_12063624 | 3300010049 | Unclassified | 712 |
| 106 | Ga0123353_11094352 | 3300010167 | Unclassified | 1059 |
| 107 | Ga0123353_11442575 | 3300010167 | Bacteria | 881 |
| 108 | Ga0123353_11448625 | 3300010167 | Bacteria | 879 |
| 109 | Ga0466703_226363 | 3300042636 | Bacteria | 40320 |
| 110 | Ga0466725_254817 | 3300042654 | Bacteria | 1109 |
| 111 | Ga0466727_314117 | 3300042655 | Unclassified | 1444 |
| 112 | Ga0466706_045096 | 3300042599 | Unclassified | 4979 |
| 113 | Ga0466706_068979 | 3300042599 | Bacteria | 13836 |
| 114 | Ga0466706_086573 | 3300042599 | Bacteria | 1831 |
| 115 | Ga0466706_207116 | 3300042599 | Bacteria | 5297 |
| 116 | Ga0466713_043179 | 3300042602 | Bacteria | 3840 |
| 117 | Ga0466714_113369 | 3300042603 | Bacteria | 1562 |
| 118 | Ga0466714_167995 | 3300042603 | Unclassified | 1319 |
| 119 | Ga0160441_100050 | 3300012825 | Bacteria | 157930 |
| 120 | Ga0415639_001440 | 3300038395 | Unclassified | 20852 |
| 121 | Ga0415639_003286 | 3300038395 | Bacteria | 56769 |
| 122 | Ga0415639_003489 | 3300038395 | Bacteria | 30262 |
| 123 | Ga0415639_009362 | 3300038395 | Bacteria | 20604 |
| 124 | Ga0415639_035524 | 3300038395 | Unclassified | 4031 |
| 125 | Ga0415639_147988 | 3300038395 | Unclassified | 1976 |
| 126 | Ga0466690_370583 | 3300042590 | Bacteria | 1768 |
| 127 | Ga0466691_093576 | 3300042593 | Bacteria | 6639 |
| 128 | Ga0466696_291332 | 3300042596 | Bacteria | 18838 |
| 129 | Ga0466697_252838 | 3300042611 | Unclassified | 3611 |
| 130 | Ga0466733_102568 | 3300042659 | Bacteria | 1653 |
| 131 | IMNBGM34_c014378 | 3300000036 | Bacteria | 987 |
| 132 | IMNBL1DRAFT_c0026482 | 3300000062 | Bacteria | 2200 |
| 133 | JGI24695J34938_10002382 | 3300002450 | Bacteria | 14466 |
| 134 | Ga0072940_1413584 | 3300005200 | Bacteria | 786 |
| 135 | Ga0466726_007795 | 3300042619 | Bacteria | 28245 |
| 136 | Ga0466728_160188 | 3300042620 | Bacteria | 19868 |
| 137 | Ga0123357_10534581 | 3300009784 | Bacteria | 947 |
| 138 | Ga0123355_10391355 | 3300009826 | Bacteria | 1801 |
| 139 | Ga0123355_10969997 | 3300009826 | Bacteria | 909 |
| 140 | Ga0123356_10040004 | 3300010049 | Bacteria | 4369 |
| 141 | Ga0123356_10044366 | 3300010049 | Bacteria | 4139 |
| 142 | Ga0123356_10877552 | 3300010049 | Unclassified | 1068 |
| 143 | Ga0123356_11505771 | 3300010049 | Bacteria | 830 |
| 144 | Ga0123356_12833111 | 3300010049 | Bacteria | 607 |
| 145 | Ga0123353_10052647 | 3300010167 | Bacteria | 6501 |
| 146 | Ga0123353_10928081 | 3300010167 | Unclassified | 1181 |
| 147 | Ga0123353_12294074 | 3300010167 | Bacteria | 649 |
| 148 | Ga0466702_150211 | 3300042635 | Bacteria | 1319 |
| 149 | Ga0466706_139715 | 3300042599 | Bacteria | 3510 |
| 150 | Ga0466706_141187 | 3300042599 | Unclassified | 1768 |
| 151 | Ga0466706_160300 | 3300042599 | Bacteria | 3217 |
| 152 | Ga0466714_031869 | 3300042603 | Bacteria | 28020 |
| 153 | Ga0466717_156284 | 3300042604 | Unclassified | 1130 |
| 154 | Ga0466719_024368 | 3300042606 | Bacteria | 1881 |
| 155 | Ga0466721_208753 | 3300042608 | Unclassified | 13525 |
| 156 | Ga0415639_003747 | 3300038395 | Bacteria | 47783 |
| 157 | Ga0466693_067613 | 3300042592 | Bacteria | 2617 |
| 158 | Ga0466691_047451 | 3300042593 | Bacteria | 66373 |
| 159 | Ga0466696_310822 | 3300042596 | Bacteria | 5274 |
| 160 | Ga0466733_001402 | 3300042659 | Bacteria | 14257 |
| 161 | JGI24703J35330_10824829 | 3300002501 | Bacteria | 546 |
| 162 | Ga0072940_1063346 | 3300005200 | Bacteria | 5554 |
| 163 | Ga0466723_188685 | 3300042618 | Bacteria | 25779 |
| 164 | Ga0123355_10019769 | 3300009826 | Bacteria | 10731 |
| 165 | Ga0123356_10123695 | 3300010049 | Unclassified | 2521 |
| 166 | Ga0123356_10364342 | 3300010049 | Bacteria | 1573 |
| 167 | Ga0123356_10589545 | 3300010049 | Unclassified | 1276 |
| 168 | Ga0123356_11366784 | 3300010049 | Unclassified | 870 |
| 169 | Ga0123353_10000009 | 3300010167 | Bacteria | 250725 |
| 170 | Ga0123353_10335908 | 3300010167 | Bacteria | 2284 |
| 171 | Ga0123353_10337692 | 3300010167 | Bacteria | 2277 |
| 172 | Ga0123353_11188783 | 3300010167 | Bacteria | 1002 |
| 173 | Ga0466734_108459 | 3300042623 | Unclassified | 2382 |
| 174 | Ga0466735_048847 | 3300042624 | Unclassified | 4117 |
| 175 | Ga0466735_183647 | 3300042624 | Bacteria | 8117 |
| 176 | Ga0466702_100748 | 3300042635 | Bacteria | 2645 |
| 177 | Ga0466702_300819 | 3300042635 | Unclassified | 11774 |
| 178 | Ga0466703_190868 | 3300042636 | Bacteria | 1234 |
| 179 | Ga0466703_344093 | 3300042636 | Bacteria | 4521 |
| 180 | Ga0466706_009937 | 3300042599 | Unclassified | 1668 |
| 181 | Ga0466706_049691 | 3300042599 | Bacteria | 14796 |
| 182 | Ga0466706_230698 | 3300042599 | Bacteria | 1721 |
| 183 | Ga0466700_386708 | 3300042600 | Bacteria | 1311 |
| 184 | Ga0466707_203280 | 3300042601 | Bacteria | 20397 |
| 185 | Ga0466713_118629 | 3300042602 | Bacteria | 1252 |
| 186 | Ga0466714_001416 | 3300042603 | Bacteria | 8844 |
| 187 | Ga0466721_297349 | 3300042608 | Bacteria | 4425 |
| 188 | Ga0466721_396237 | 3300042608 | Unclassified | 6771 |
| 189 | Ga0466691_181362 | 3300042593 | Unclassified | 1876 |
| 190 | Ga0466696_019962 | 3300042596 | Bacteria | 3126 |
| 191 | Ga0466696_134620 | 3300042596 | Unclassified | 9124 |
| 192 | Ga0466705_311367 | 3300042612 | Unclassified | 3109 |
| 193 | Ga0466733_155177 | 3300042659 | Unclassified | 1364 |
| 194 | IMNBL1DRAFT_c0000560 | 3300000062 | Bacteria | 30041 |
| 195 | IMNBL1DRAFT_c0003278 | 3300000062 | Bacteria | 10542 |
| 196 | JGI24695J34938_10224028 | 3300002450 | Bacteria | 790 |
| 197 | JGI24702J35022_10073279 | 3300002462 | Bacteria | 1847 |
| 198 | JGI24700J35501_10930614 | 3300002508 | Bacteria | 16776 |
| 199 | Ga0466711_259844 | 3300042615 | Bacteria | 12595 |
| 200 | Ga0466711_483081 | 3300042615 | Unclassified | 1775 |
| 201 | Ga0466726_186040 | 3300042619 | Unclassified | 6573 |
| 202 | Ga0123355_11259037 | 3300009826 | Bacteria | 747 |
| 203 | Ga0123356_10000211 | 3300010049 | Bacteria | 67882 |
| 204 | Ga0123356_12002459 | 3300010049 | Unclassified | 722 |
| 205 | Ga0123353_10000210 | 3300010167 | Bacteria | 74209 |
| 206 | Ga0123353_10057787 | 3300010167 | Unclassified | 6214 |
| 207 | Ga0123353_10149388 | 3300010167 | Unclassified | 3732 |
| 208 | Ga0123353_10691833 | 3300010167 | Bacteria | 1433 |
| 209 | Ga0123353_11927278 | 3300010167 | Archaea | 728 |
| 210 | Ga0123354_10288550 | 3300010882 | Bacteria | 1577 |
| 211 | Ga0466708_328456 | 3300042652 | Unclassified | 3119 |
| 212 | Ga0466706_002353 | 3300042599 | Bacteria | 1236 |
| 213 | Ga0466706_044311 | 3300042599 | Bacteria | 66484 |
| 214 | Ga0466706_070477 | 3300042599 | Bacteria | 8819 |
| 215 | Ga0466706_104680 | 3300042599 | Bacteria | 1184 |
| 216 | Ga0466706_113469 | 3300042599 | Unclassified | 14883 |
| 217 | Ga0466706_236555 | 3300042599 | Unclassified | 1409 |
| 218 | Ga0466706_274415 | 3300042599 | Bacteria | 19452 |
| 219 | Ga0466706_287116 | 3300042599 | Bacteria | 11278 |
| 220 | Ga0466706_287978 | 3300042599 | Unclassified | 9318 |
| 221 | Ga0466700_217596 | 3300042600 | Unclassified | 1938 |
| 222 | Ga0466707_253010 | 3300042601 | Bacteria | 1015 |
| 223 | Ga0466707_385787 | 3300042601 | Bacteria | 2447 |
| 224 | Ga0466714_016669 | 3300042603 | Unclassified | 9498 |
| 225 | Ga0466721_160537 | 3300042608 | Bacteria | 71411 |
| 226 | Ga0160443_101196 | 3300012848 | Bacteria | 9963 |
| 227 | Ga0415639_054312 | 3300038395 | Bacteria | 19658 |
| 228 | Ga0466657_198591 | 3300042582 | Bacteria | 1032 |
| 229 | Ga0466696_161172 | 3300042596 | Unclassified | 1468 |
| 230 | Ga0466705_213940 | 3300042612 | Bacteria | 4186 |
| 231 | JGI24695J34938_10044316 | 3300002450 | Bacteria | 1979 |
| 232 | JGI24702J35022_10041865 | 3300002462 | Unclassified | 2441 |
| 233 | JGI24703J35330_11748815 | 3300002501 | Bacteria | 40125 |
| 234 | JGI24705J35276_12067338 | 3300002504 | Unclassified | 947 |
| 235 | Ga0466705_503960 | 3300042612 | Bacteria | 2021 |
| 236 | Ga0466726_050605 | 3300042619 | Unclassified | 1462 |
| 237 | Ga0123355_10084945 | 3300009826 | Bacteria | 5038 |
| 238 | Ga0123356_10090653 | 3300010049 | Bacteria | 2912 |
| 239 | Ga0123356_11075879 | 3300010049 | Bacteria | 973 |
| 240 | Ga0123353_10001482 | 3300010167 | Bacteria | 28745 |
| 241 | Ga0123353_10764879 | 3300010167 | Bacteria | 1341 |
| 242 | Ga0123353_11534261 | 3300010167 | Bacteria | 846 |
| 243 | Ga0466735_227071 | 3300042624 | Bacteria | 4109 |
| 244 | Ga0466702_069721 | 3300042635 | Unclassified | 1094 |
| 245 | Ga0466708_455439 | 3300042652 | Bacteria | 37281 |
| 246 | Ga0466725_258555 | 3300042654 | Bacteria | 1466 |
| 247 | Ga0466706_099569 | 3300042599 | Bacteria | 1693 |
| 248 | Ga0466706_162528 | 3300042599 | Bacteria | 4468 |
| 249 | Ga0466706_163506 | 3300042599 | Unclassified | 1866 |
| 250 | Ga0466706_167648 | 3300042599 | Unclassified | 4759 |
| 251 | Ga0466700_116925 | 3300042600 | Bacteria | 7130 |
| 252 | Ga0466714_159740 | 3300042603 | Unclassified | 1666 |
| 253 | Ga0466716_326031 | 3300042605 | Unclassified | 1252 |
| 254 | Ga0466716_530767 | 3300042605 | Unclassified | 6806 |
| 255 | Ga0466719_033749 | 3300042606 | Bacteria | 1263 |
| 256 | Ga0415639_036190 | 3300038395 | Unclassified | 1816 |
| 257 | Ga0415639_070016 | 3300038395 | Bacteria | 10912 |
| 258 | Ga0415639_105714 | 3300038395 | Unclassified | 2638 |
| 259 | Ga0399895_096880 | 3300038763 | Bacteria | 783 |
| 260 | Ga0466694_006227 | 3300042594 | Bacteria | 1082 |
| 261 | Ga0466705_178361 | 3300042612 | Unclassified | 6393 |
| 262 | JGI24703J35330_11185876 | 3300002501 | Bacteria | 750 |
| 263 | JGI24696J40584_12316711 | 3300002834 | Bacteria | 524 |
| 264 | Ga0068302_10507938 | 3300005071 | Bacteria | 2941 |
| 265 | Ga0466723_300049 | 3300042618 | Bacteria | 28695 |
| 266 | Ga0123357_10410149 | 3300009784 | Bacteria | 1222 |
| 267 | Ga0123355_10000450 | 3300009826 | Bacteria | 53983 |
| 268 | Ga0123355_10000559 | 3300009826 | Bacteria | 49930 |
| 269 | Ga0123355_10066657 | 3300009826 | Bacteria | 5794 |
| 270 | Ga0123355_10594120 | 3300009826 | Bacteria | 1317 |
| 271 | Ga0123355_12184553 | 3300009826 | Bacteria | 506 |
| 272 | Ga0123356_10002462 | 3300010049 | Bacteria | 19766 |
| 273 | Ga0123356_10395120 | 3300010049 | Unclassified | 1519 |
| 274 | Ga0123356_12972628 | 3300010049 | Unclassified | 592 |
| 275 | Ga0123353_10388484 | 3300010167 | Bacteria | 2083 |
| 276 | Ga0123353_10401278 | 3300010167 | Unclassified | 2040 |
| 277 | Ga0123353_10820675 | 3300010167 | Unclassified | 1280 |
| 278 | Ga0466702_403559 | 3300042635 | Bacteria | 1260 |
| 279 | Ga0466727_268995 | 3300042655 | Bacteria | 8560 |
| 280 | Ga0466706_057965 | 3300042599 | Bacteria | 2535 |
| 281 | Ga0466714_164884 | 3300042603 | Bacteria | 1296 |
| 282 | Ga0466716_467781 | 3300042605 | Bacteria | 1537 |
| 283 | Ga0466721_029758 | 3300042608 | Bacteria | 2194 |
| 284 | Ga0466721_174989 | 3300042608 | Bacteria | 226195 |
| 285 | Ga0466722_094991 | 3300042609 | Bacteria | 3258 |
| 286 | Ga0160452_100096 | 3300012834 | Bacteria | 116013 |
| 287 | Ga0415639_027220 | 3300038395 | Bacteria | 8951 |
| 288 | Ga0415639_029990 | 3300038395 | Bacteria | 23871 |
| 289 | Ga0415639_055827 | 3300038395 | Bacteria | 4459 |
| 290 | Ga0466693_376239 | 3300042592 | Unclassified | 2548 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00072 | Response_reg | Response regulator receiver domain | 29 | 139 | 0.99 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00072 | GO:0000160 | phosphorelay signal transduction system | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.