Protein Family IF05636
Metagenome
Isolate
234
Members
74
Samples
210
Scaffolds
154.18
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_165285|Ga0466706_165285_335_868
- Length
- 177 aa
- Sequence
- MPAKRVLLLPVIMLSATKHHLLEKIDKLDRRILSIISRNARIPFKDVADDCGVSRAAIHQRVQRLMEMNVITGSGYIINPKSLGYNTCTYIGVRLEKGSLYKDVVPEFEKIPEIVECHFTTGPYTLLIKLYARDNEHLMDLLNNRIQEIKGVISTETLISLQQSFKRVFPILEEELD
Sample Types
Isolate
10.3%
Metagenome
89.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
28.8%
Kalotermitidae
19.2%
Blattidae
16.4%
Unclassified
13.7%
Rhinotermitidae
8.2%
Termopsidae
5.5%
Passalidae
2.7%
Hydrophilidae
2.7%
Tenebrionidae
1.4%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
186
Eukaryota
0
Viruses
0
Unclassified
48
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 2 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 3 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 4 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 5 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 6 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 7 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 10 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 13 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 18 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 23 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 24 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 25 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 26 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 27 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 30 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 31 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 32 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 33 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 34 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 35 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 36 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 37 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 38 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 39 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 42 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 43 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 44 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 45 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 46 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 47 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 48 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 49 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 50 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 51 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 52 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 53 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 54 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 55 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 56 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 57 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 58 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 59 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 60 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 61 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 62 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 63 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 64 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 65 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 66 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 67 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 68 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 69 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 70 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 71 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 72 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 73 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 74 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466734_111944 | 3300042623 | Unclassified | 1419 |
| 2 | Ga0466735_053167 | 3300042624 | Bacteria | 12883 |
| 3 | Ga0466735_114353 | 3300042624 | Bacteria | 3208 |
| 4 | Ga0466735_183207 | 3300042624 | Unclassified | 2771 |
| 5 | Ga0466703_230741 | 3300042636 | Bacteria | 2960 |
| 6 | Ga0123357_10157813 | 3300009784 | Unclassified | 2730 |
| 7 | Ga0123354_10017885 | 3300010882 | Bacteria | 11106 |
| 8 | 2227501025 | 2225789004 | Bacteria | 3801 |
| 9 | Ga0466706_068903 | 3300042599 | Bacteria | 60225 |
| 10 | Ga0466707_026565 | 3300042601 | Bacteria | 22320 |
| 11 | Ga0466707_413525 | 3300042601 | Unclassified | 1274 |
| 12 | Ga0466716_167552 | 3300042605 | Bacteria | 8313 |
| 13 | Ga0466716_269761 | 3300042605 | Bacteria | 47718 |
| 14 | Ga0466715_077989 | 3300042616 | Unclassified | 24406 |
| 15 | Ga0466715_080615 | 3300042616 | Bacteria | 6731 |
| 16 | Ga0466729_006737 | 3300042621 | Bacteria | 1908 |
| 17 | Ga0466729_123526 | 3300042621 | Bacteria | 33019 |
| 18 | Ga0466735_001908 | 3300042624 | Bacteria | 6451 |
| 19 | Ga0466735_111269 | 3300042624 | Bacteria | 1659 |
| 20 | Ga0466703_121300 | 3300042636 | Bacteria | 23338 |
| 21 | Ga0466704_362900 | 3300042643 | Bacteria | 3307 |
| 22 | Ga0466709_194109 | 3300042648 | Bacteria | 4700 |
| 23 | Ga0466708_004518 | 3300042652 | Bacteria | 5455 |
| 24 | Ga0466656_333314 | 3300042550 | Unclassified | 3062 |
| 25 | Ga0466692_051866 | 3300042591 | Bacteria | 27413 |
| 26 | Ga0466691_118930 | 3300042593 | Bacteria | 12858 |
| 27 | Ga0466696_489529 | 3300042596 | Bacteria | 2726 |
| 28 | Ga0123353_10016746 | 3300010167 | Bacteria | 10731 |
| 29 | Ga0123353_10048891 | 3300010167 | Bacteria | 6736 |
| 30 | Ga0123354_10211155 | 3300010882 | Unclassified | 2097 |
| 31 | Ga0466706_169140 | 3300042599 | Unclassified | 1407 |
| 32 | Ga0466700_067116 | 3300042600 | Bacteria | 9010 |
| 33 | Ga0466707_043098 | 3300042601 | Unclassified | 1127 |
| 34 | Ga0466707_069539 | 3300042601 | Bacteria | 27090 |
| 35 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 36 | Ga0466714_070170 | 3300042603 | Bacteria | 1605 |
| 37 | Ga0466719_281655 | 3300042606 | Bacteria | 11106 |
| 38 | Ga0466715_122714 | 3300042616 | Bacteria | 16938 |
| 39 | Ga0466715_131615 | 3300042616 | Bacteria | 7439 |
| 40 | Ga0466715_196076 | 3300042616 | Bacteria | 18016 |
| 41 | Ga0466726_003419 | 3300042619 | Bacteria | 66294 |
| 42 | Ga0466726_444946 | 3300042619 | Unclassified | 1033 |
| 43 | Ga0466705_019804 | 3300042612 | Bacteria | 8075 |
| 44 | Ga0466733_220847 | 3300042659 | Bacteria | 2891 |
| 45 | Ga0466735_186683 | 3300042624 | Unclassified | 3936 |
| 46 | Ga0466703_036562 | 3300042636 | Unclassified | 2344 |
| 47 | Ga0466703_169017 | 3300042636 | Unclassified | 1943 |
| 48 | Ga0466703_263613 | 3300042636 | Unclassified | 4119 |
| 49 | Ga0466704_616033 | 3300042643 | Unclassified | 2163 |
| 50 | Ga0466693_373503 | 3300042592 | Bacteria | 1095 |
| 51 | Ga0123354_10000973 | 3300010882 | Bacteria | 32464 |
| 52 | 2227613491 | 2225789004 | Bacteria | 12063 |
| 53 | JGI24699J35502_11000814 | 3300002509 | Unclassified | 1352 |
| 54 | JGI24699J35502_11133777 | 3300002509 | Bacteria | 15436 |
| 55 | Ga0068305_10034606 | 3300005083 | Bacteria | 4774 |
| 56 | Ga0068305_10055753 | 3300005083 | Unclassified | 2969 |
| 57 | Ga0123357_10000304 | 3300009784 | Bacteria | 46843 |
| 58 | Ga0466706_058713 | 3300042599 | Bacteria | 36381 |
| 59 | Ga0466706_167201 | 3300042599 | Bacteria | 2339 |
| 60 | Ga0466707_182648 | 3300042601 | Unclassified | 3329 |
| 61 | Ga0466707_281523 | 3300042601 | Bacteria | 23923 |
| 62 | Ga0466707_325770 | 3300042601 | Unclassified | 1913 |
| 63 | Ga0466707_407287 | 3300042601 | Bacteria | 7357 |
| 64 | Ga0466713_140716 | 3300042602 | Bacteria | 27446 |
| 65 | Ga0466722_026761 | 3300042609 | Bacteria | 6194 |
| 66 | Ga0466722_113613 | 3300042609 | Bacteria | 129604 |
| 67 | Ga0466697_046526 | 3300042611 | Unclassified | 1500 |
| 68 | Ga0466710_016584 | 3300042613 | Bacteria | 1440 |
| 69 | Ga0466711_031881 | 3300042615 | Bacteria | 12261 |
| 70 | Ga0466705_317740 | 3300042612 | Bacteria | 1932 |
| 71 | Ga0466734_088283 | 3300042623 | Bacteria | 1512 |
| 72 | Ga0466735_045510 | 3300042624 | Bacteria | 3523 |
| 73 | Ga0466735_133231 | 3300042624 | Bacteria | 7647 |
| 74 | Ga0466735_186714 | 3300042624 | Bacteria | 1424 |
| 75 | Ga0466735_221755 | 3300042624 | Bacteria | 1254 |
| 76 | Ga0466735_224480 | 3300042624 | Unclassified | 1245 |
| 77 | Ga0466708_081379 | 3300042652 | Bacteria | 9084 |
| 78 | Ga0466727_033162 | 3300042655 | Bacteria | 6271 |
| 79 | Ga0466690_139910 | 3300042590 | Bacteria | 15432 |
| 80 | Ga0466695_022079 | 3300042595 | Unclassified | 4880 |
| 81 | Ga0466696_041201 | 3300042596 | Unclassified | 1482 |
| 82 | Ga0123354_10006490 | 3300010882 | Bacteria | 17390 |
| 83 | JGI24702J35022_10003443 | 3300002462 | Bacteria | 9533 |
| 84 | JGI24702J35022_10307541 | 3300002462 | Bacteria | 937 |
| 85 | JGI24696J40584_12960195 | 3300002834 | Bacteria | 6566 |
| 86 | Ga0072941_1766066 | 3300005201 | Bacteria | 919 |
| 87 | Ga0466706_189118 | 3300042599 | Bacteria | 1537 |
| 88 | Ga0466706_228999 | 3300042599 | Unclassified | 1015 |
| 89 | Ga0466700_181990 | 3300042600 | Bacteria | 20709 |
| 90 | Ga0466707_125838 | 3300042601 | Bacteria | 3739 |
| 91 | Ga0466713_018228 | 3300042602 | Bacteria | 4222 |
| 92 | Ga0466713_027832 | 3300042602 | Bacteria | 2091 |
| 93 | Ga0466719_322149 | 3300042606 | Bacteria | 2276 |
| 94 | Ga0466698_479857 | 3300042610 | Unclassified | 1613 |
| 95 | Ga0466711_122506 | 3300042615 | Bacteria | 25618 |
| 96 | Ga0466711_133415 | 3300042615 | Bacteria | 7335 |
| 97 | Ga0466711_329548 | 3300042615 | Bacteria | 10051 |
| 98 | Ga0466715_203207 | 3300042616 | Bacteria | 19545 |
| 99 | Ga0466715_233277 | 3300042616 | Bacteria | 3519 |
| 100 | Ga0466723_054943 | 3300042618 | Bacteria | 9814 |
| 101 | Ga0466728_457777 | 3300042620 | Unclassified | 1304 |
| 102 | Ga0466729_222099 | 3300042621 | Bacteria | 9877 |
| 103 | Ga0466735_052175 | 3300042624 | Bacteria | 1680 |
| 104 | Ga0466735_065230 | 3300042624 | Bacteria | 13716 |
| 105 | Ga0466735_093538 | 3300042624 | Bacteria | 1889 |
| 106 | Ga0466735_134261 | 3300042624 | Unclassified | 2745 |
| 107 | Ga0466703_157799 | 3300042636 | Bacteria | 30527 |
| 108 | Ga0466704_419667 | 3300042643 | Bacteria | 19776 |
| 109 | Ga0466709_008379 | 3300042648 | Bacteria | 52460 |
| 110 | Ga0466727_121295 | 3300042655 | Bacteria | 5460 |
| 111 | Ga0466727_171215 | 3300042655 | Bacteria | 2929 |
| 112 | Ga0466727_211636 | 3300042655 | Bacteria | 4725 |
| 113 | Ga0466690_049510 | 3300042590 | Bacteria | 1423 |
| 114 | Ga0466690_173634 | 3300042590 | Bacteria | 20155 |
| 115 | Ga0466690_374112 | 3300042590 | Bacteria | 9726 |
| 116 | Ga0466693_261614 | 3300042592 | Bacteria | 1089 |
| 117 | Ga0466696_165087 | 3300042596 | Unclassified | 1529 |
| 118 | Ga0466696_378005 | 3300042596 | Bacteria | 15291 |
| 119 | Ga0123357_10040843 | 3300009784 | Bacteria | 6309 |
| 120 | Ga0123353_11244722 | 3300010167 | Bacteria | 972 |
| 121 | Ga0123354_10000042 | 3300010882 | Bacteria | 95103 |
| 122 | Ga0123354_10034407 | 3300010882 | Bacteria | 7924 |
| 123 | JGI24699J35502_11133915 | 3300002509 | Bacteria | 19166 |
| 124 | Ga0466701_062430 | 3300042598 | Bacteria | 10398 |
| 125 | Ga0466706_174920 | 3300042599 | Bacteria | 12699 |
| 126 | Ga0466706_186023 | 3300042599 | Bacteria | 49026 |
| 127 | Ga0466707_366642 | 3300042601 | Unclassified | 5252 |
| 128 | Ga0466719_215044 | 3300042606 | Bacteria | 2866 |
| 129 | Ga0466722_079151 | 3300042609 | Bacteria | 34331 |
| 130 | Ga0466711_073309 | 3300042615 | Bacteria | 34308 |
| 131 | Ga0466711_421256 | 3300042615 | Bacteria | 3308 |
| 132 | Ga0466733_203254 | 3300042659 | Bacteria | 17585 |
| 133 | Ga0466735_122870 | 3300042624 | Bacteria | 8875 |
| 134 | Ga0466704_213209 | 3300042643 | Bacteria | 10647 |
| 135 | Ga0466709_269854 | 3300042648 | Unclassified | 6155 |
| 136 | Ga0123357_10034644 | 3300009784 | Bacteria | 6864 |
| 137 | JGI24705J35276_12218793 | 3300002504 | Unclassified | 2166 |
| 138 | JGI24699J35502_11134159 | 3300002509 | Bacteria | 40635 |
| 139 | Ga0068302_10662913 | 3300005071 | Unclassified | 671 |
| 140 | Ga0068302_10744561 | 3300005071 | Bacteria | 955 |
| 141 | Ga0466706_189871 | 3300042599 | Bacteria | 61075 |
| 142 | Ga0466713_018958 | 3300042602 | Bacteria | 6273 |
| 143 | Ga0466713_066709 | 3300042602 | Bacteria | 6893 |
| 144 | Ga0466713_072434 | 3300042602 | Bacteria | 14880 |
| 145 | Ga0466714_144443 | 3300042603 | Bacteria | 1680 |
| 146 | Ga0466716_261680 | 3300042605 | Bacteria | 2619 |
| 147 | Ga0466722_043481 | 3300042609 | Unclassified | 5056 |
| 148 | Ga0466722_055450 | 3300042609 | Unclassified | 4220 |
| 149 | Ga0466722_108627 | 3300042609 | Bacteria | 25768 |
| 150 | Ga0466723_160022 | 3300042618 | Unclassified | 2223 |
| 151 | Ga0466705_067860 | 3300042612 | Bacteria | 1000 |
| 152 | Ga0466732_293125 | 3300042656 | Bacteria | 1102 |
| 153 | Ga0466733_081782 | 3300042659 | Bacteria | 22829 |
| 154 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 155 | Ga0466735_229491 | 3300042624 | Bacteria | 1715 |
| 156 | Ga0466708_082662 | 3300042652 | Bacteria | 8192 |
| 157 | Ga0466690_217677 | 3300042590 | Bacteria | 30896 |
| 158 | Ga0466692_023608 | 3300042591 | Bacteria | 56587 |
| 159 | Ga0466691_157130 | 3300042593 | Bacteria | 6456 |
| 160 | Ga0466694_050857 | 3300042594 | Unclassified | 1114 |
| 161 | Ga0466696_134183 | 3300042596 | Bacteria | 2076 |
| 162 | Ga0123357_10755263 | 3300009784 | Unclassified | 675 |
| 163 | Ga0123356_10006894 | 3300010049 | Bacteria | 11417 |
| 164 | Ga0123354_10124077 | 3300010882 | Bacteria | 3312 |
| 165 | IMNBL1DRAFT_c0001304 | 3300000062 | Bacteria | 18756 |
| 166 | IMNBL1DRAFT_c0002191 | 3300000062 | Bacteria | 13785 |
| 167 | JGI24702J35022_10508315 | 3300002462 | Unclassified | 739 |
| 168 | Ga0068305_10002225 | 3300005083 | Bacteria | 58608 |
| 169 | Ga0068305_10144849 | 3300005083 | Bacteria | 1612 |
| 170 | Ga0466701_029476 | 3300042598 | Unclassified | 1233 |
| 171 | Ga0466706_165285 | 3300042599 | Bacteria | 1154 |
| 172 | Ga0466706_231678 | 3300042599 | Bacteria | 6190 |
| 173 | Ga0466706_253111 | 3300042599 | Bacteria | 28156 |
| 174 | Ga0466706_260547 | 3300042599 | Unclassified | 4638 |
| 175 | Ga0466707_060912 | 3300042601 | Bacteria | 42028 |
| 176 | Ga0466713_023961 | 3300042602 | Unclassified | 4010 |
| 177 | Ga0466713_070338 | 3300042602 | Bacteria | 49717 |
| 178 | Ga0466713_137026 | 3300042602 | Bacteria | 2508 |
| 179 | Ga0466719_094709 | 3300042606 | Bacteria | 5719 |
| 180 | Ga0466719_529978 | 3300042606 | Unclassified | 1104 |
| 181 | Ga0466705_399999 | 3300042612 | Bacteria | 19920 |
| 182 | Ga0466723_367494 | 3300042618 | Bacteria | 7678 |
| 183 | Ga0466728_412588 | 3300042620 | Bacteria | 41529 |
| 184 | Ga0466735_099896 | 3300042624 | Unclassified | 1053 |
| 185 | Ga0466703_013363 | 3300042636 | Unclassified | 1704 |
| 186 | Ga0466703_177758 | 3300042636 | Bacteria | 25094 |
| 187 | Ga0466704_138330 | 3300042643 | Bacteria | 23749 |
| 188 | Ga0466704_504344 | 3300042643 | Bacteria | 24931 |
| 189 | Ga0466708_067210 | 3300042652 | Unclassified | 5850 |
| 190 | Ga0466692_170802 | 3300042591 | Bacteria | 10493 |
| 191 | Ga0466691_145005 | 3300042593 | Bacteria | 30331 |
| 192 | Ga0123357_10020032 | 3300009784 | Bacteria | 8931 |
| 193 | Ga0123357_10398578 | 3300009784 | Bacteria | 1255 |
| 194 | Ga0123356_12458346 | 3300010049 | Unclassified | 652 |
| 195 | Ga0123354_10009255 | 3300010882 | Bacteria | 15061 |
| 196 | Ga0123354_10031945 | 3300010882 | Bacteria | 8258 |
| 197 | 2227474084 | 2225789004 | Bacteria | 4729 |
| 198 | JGI24702J35022_10013910 | 3300002462 | Bacteria | 4447 |
| 199 | JGI24705J35276_12231194 | 3300002504 | Bacteria | 3858 |
| 200 | JGI24696J40584_12908822 | 3300002834 | Unclassified | 1239 |
| 201 | Ga0123357_10001807 | 3300009784 | Bacteria | 23177 |
| 202 | Ga0466706_250850 | 3300042599 | Bacteria | 6158 |
| 203 | Ga0466700_146096 | 3300042600 | Bacteria | 30717 |
| 204 | Ga0466707_168419 | 3300042601 | Bacteria | 12239 |
| 205 | Ga0466707_369642 | 3300042601 | Bacteria | 1930 |
| 206 | Ga0466713_035671 | 3300042602 | Bacteria | 26418 |
| 207 | Ga0466716_166510 | 3300042605 | Bacteria | 2540 |
| 208 | Ga0466715_028361 | 3300042616 | Bacteria | 5141 |
| 209 | Ga0466729_047723 | 3300042621 | Bacteria | 13388 |
| 210 | Ga0466729_104276 | 3300042621 | Unclassified | 3737 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF13404 | GO:0043565 | sequence-specific DNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.