Protein Family IF05628

Metagenome Isolate
159 Members
65 Samples
127 Scaffolds
344.78 Avg Length

🧬 Representative Sequence

ID
3300042599|Ga0466706_151904|Ga0466706_151904_403_1518
Length
371 aa
Sequence
MHKTGTFFKGFNKMLETSSFEFDADISAERLVSPRETEIDSTDDIDLTLRPKTLSEYIGQDKVKENMAVFIEAARKRAEPLDHVLLYGPPGLGKTTLSCIIAHEMGVNIRITSGPAIEKAGDLAAILTNLSPNDVLFIDEIHRLNRQVEEIMYPALEDYALDIIVGKGPSARSIRIDLPKFTLIGATTRAGQLSAPLRDRFGVVMRLELYNFEQLTDIVLRSSVILGIPCDKAGALEIAKRSRGTPRIANRLLKRVRDFAEVLGTGKVTEEIAKIALDRLEIDSXGLDSMDKRFLEMIIKGYSGGPVGLETLAAAIGEEAVTLEDVCEPYLMQLGFLSRTPRGRCATAIAYNHMGYQAPAVIQTPQISLLD

📊 Sample Types

Isolate 20.1%
Metagenome 79.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 40.0%
Termitidae 27.7%
Kalotermitidae 13.8%
Blattidae 4.6%
Stratiomyidae 3.1%
Passalidae 3.1%
Termopsidae 3.1%
Scarabaeidae 1.5%
Hodotermitidae 1.5%
Apidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 142
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
2 2820348946 Unclassified Firmicutes Nt197P3bin47 Isolate Unclassified
3 2820467504 Unclassified Firmicutes Lab288P3bin1 Isolate Unclassified
4 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
5 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
6 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
7 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2963634138 Unclassified Bacilli bacterium PM5-3 Isolate Blattidae
14 2590828839 Clostridium sp. 1 Isolate Termitidae
15 2820651690 Unclassified Firmicutes Cu122P3bin6 Isolate Unclassified
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
18 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
19 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
20 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
21 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
22 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
23 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
24 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
25 2820613375 Unclassified Firmicutes Emb289P1bin134 Isolate Unclassified
26 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
27 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
28 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
29 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
30 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
31 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
32 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
35 2963635624 Unclassified Bacilli bacterium PM5-9 Isolate Blattidae
36 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
37 2820429680 Unclassified Firmicutes Lab288P3bin30 Isolate Unclassified
38 2820510699 Unclassified Firmicutes Lab288P1bin40 Isolate Unclassified
39 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
40 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
41 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
42 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
43 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
44 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
45 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
46 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
47 2820893114 Unclassified Actinobacteria Lab288P1bin125 Isolate Unclassified
48 2820460928 Unclassified Firmicutes Lab288P3bin140 Isolate Unclassified
49 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
50 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
51 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
52 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
53 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
54 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
55 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
56 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
57 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
58 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
59 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
60 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
61 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
62 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
63 2820646798 Unclassified Firmicutes Cu122P5bin36 Isolate Unclassified
64 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
65 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10032358 3300010049 Bacteria 4893
2 Ga0123353_10033146 3300010167 Bacteria 8036
3 Ga0415639_206963 3300038395 Bacteria 2448
4 Ga0466693_013649 3300042592 Bacteria 10103
5 Ga0466706_021154 3300042599 Bacteria 130141
6 Ga0466706_123002 3300042599 Bacteria 8824
7 Ga0466706_159735 3300042599 Unclassified 17015
8 Ga0466706_210189 3300042599 Bacteria 1388
9 Ga0466706_272557 3300042599 Unclassified 2062
10 Ga0466702_455829 3300042635 Bacteria 56693
11 Ga0466703_083574 3300042636 Bacteria 2666
12 Ga0466724_01455 3300042649 Bacteria 1081
13 Ga0466705_347109 3300042612 Bacteria 3969
14 Ga0466711_507820 3300042615 Bacteria 7124
15 Ga0123355_10000837 3300009826 Bacteria 42313
16 Ga0123355_10026558 3300009826 Bacteria 9342
17 Ga0123355_10155280 3300009826 Bacteria 3464
18 Ga0123353_10000357 3300010167 Bacteria 55827
19 Ga0123353_10001944 3300010167 Bacteria 25461
20 Ga0123353_10143217 3300010167 Bacteria 3826
21 Ga0466706_013141 3300042599 Bacteria 2961
22 Ga0466706_018824 3300042599 Bacteria 21960
23 Ga0466706_024018 3300042599 Bacteria 9586
24 Ga0466706_034637 3300042599 Unclassified 29373
25 Ga0466706_079931 3300042599 Bacteria 110819
26 Ga0466706_100866 3300042599 Bacteria 3097
27 Ga0466706_101814 3300042599 Bacteria 31962
28 Ga0466706_112167 3300042599 Bacteria 25695
29 Ga0466706_194221 3300042599 Unclassified 7177
30 Ga0466706_211029 3300042599 Bacteria 1350
31 Ga0466706_224804 3300042599 Bacteria 61366
32 Ga0466716_183734 3300042605 Bacteria 316127
33 Ga0466704_076757 3300042643 Bacteria 271570
34 Ga0466704_209233 3300042643 Bacteria 84587
35 Ga0466704_221920 3300042643 Bacteria 2202
36 Ga0466733_135572 3300042659 Bacteria 3568
37 Ga0123355_10012522 3300009826 Bacteria 13142
38 Ga0123355_10296264 3300009826 Bacteria 2212
39 Ga0415639_015433 3300038395 Bacteria 26756
40 Ga0466695_189537 3300042595 Bacteria 2725
41 2227644055 2225789004 Bacteria 10970
42 Ga0466706_093098 3300042599 Bacteria 10369
43 Ga0466706_137149 3300042599 Bacteria 27048
44 Ga0466703_139813 3300042636 Bacteria 21578
45 Ga0466733_019351 3300042659 Bacteria 7450
46 Ga0466715_535374 3300042616 Bacteria 53013
47 Ga0123355_10009341 3300009826 Bacteria 14895
48 Ga0123355_10030997 3300009826 Bacteria 8673
49 Ga0123355_10113049 3300009826 Unclassified 4236
50 Ga0123356_10000006 3300010049 Bacteria 247371
51 Ga0123356_10061704 3300010049 Bacteria 3501
52 Ga0123353_10002516 3300010167 Bacteria 22784
53 Ga0123353_10006345 3300010167 Bacteria 15730
54 Ga0415639_182851 3300038395 Bacteria 3309
55 Ga0466696_085965 3300042596 Bacteria 5863
56 IMNBL1DRAFT_c0005266 3300000062 Bacteria 7456
57 JGI24702J35022_10029380 3300002462 Bacteria 2950
58 JGI24705J35276_12238177 3300002504 Bacteria 16905
59 JGI24705J35276_12238248 3300002504 Bacteria 17831
60 Ga0466706_036800 3300042599 Unclassified 31228
61 Ga0466706_046212 3300042599 Bacteria 4335
62 Ga0466706_189447 3300042599 Bacteria 7335
63 Ga0466713_136032 3300042602 Bacteria 7347
64 Ga0466714_024749 3300042603 Bacteria 9532
65 Ga0466704_330894 3300042643 Bacteria 161855
66 Ga0466711_173350 3300042615 Bacteria 4089
67 Ga0466728_414994 3300042620 Bacteria 45354
68 Ga0123357_10080426 3300009784 Bacteria 4286
69 Ga0123355_10225800 3300009826 Bacteria 2684
70 Ga0123356_10032501 3300010049 Bacteria 4880
71 Ga0123356_10125962 3300010049 Bacteria 2500
72 Ga0123353_10217445 3300010167 Bacteria 2992
73 Ga0123353_10222094 3300010167 Bacteria 2953
74 Ga0123353_10387812 3300010167 Bacteria 2086
75 IMNBL1DRAFT_c0025788 3300000062 Bacteria 2248
76 Ga0466706_045867 3300042599 Unclassified 46170
77 Ga0466706_174323 3300042599 Unclassified 1719
78 Ga0466706_206119 3300042599 Unclassified 3252
79 Ga0466706_236537 3300042599 Bacteria 33431
80 Ga0466707_410083 3300042601 Bacteria 48627
81 Ga0466733_132231 3300042659 Bacteria 1680
82 Ga0466711_031756 3300042615 Bacteria 5123
83 Ga0466726_031487 3300042619 Bacteria 6338
84 Ga0123357_10035958 3300009784 Bacteria 6737
85 Ga0123355_10005830 3300009826 Bacteria 18118
86 Ga0123355_10020298 3300009826 Unclassified 10606
87 Ga0123355_10052497 3300009826 Bacteria 6613
88 Ga0123353_10057610 3300010167 Bacteria 6224
89 Ga0072940_1006101 3300005200 Bacteria 21732
90 Ga0466706_096421 3300042599 Bacteria 77752
91 Ga0466706_107205 3300042599 Bacteria 176653
92 Ga0466735_003456 3300042624 Bacteria 38500
93 Ga0466702_145428 3300042635 Bacteria 52890
94 Ga0466702_377813 3300042635 Bacteria 3157
95 Ga0466708_052469 3300042652 Bacteria 21078
96 Ga0466733_144688 3300042659 Bacteria 13024
97 Ga0123355_10000014 3300009826 Bacteria 174606
98 Ga0123355_10503781 3300009826 Bacteria 1492
99 Ga0123356_10150465 3300010049 Unclassified 2310
100 Ga0123353_10278036 3300010167 Bacteria 2574
101 Ga0466696_293318 3300042596 Bacteria 15923
102 JGI24705J35276_12238286 3300002504 Bacteria 18525
103 Ga0466706_048704 3300042599 Unclassified 4460
104 Ga0466706_055246 3300042599 Bacteria 3415
105 Ga0466706_155338 3300042599 Bacteria 8003
106 Ga0466706_174660 3300042599 Bacteria 4083
107 Ga0466698_418298 3300042610 Bacteria 6308
108 Ga0466715_255950 3300042616 Bacteria 9027
109 Ga0466715_449604 3300042616 Bacteria 3964
110 Ga0123353_10110673 3300010167 Bacteria 4425
111 Ga0123353_10251602 3300010167 Bacteria 2736
112 Ga0415639_023872 3300038395 Bacteria 23257
113 2227469065 2225789004 Bacteria 24255
114 IMNBL1DRAFT_c0036199 3300000062 Bacteria 1727
115 AustNasuHG_c1000068 3300000089 Bacteria 28518
116 Ga0466706_007585 3300042599 Unclassified 14065
117 Ga0466706_054284 3300042599 Bacteria 5989
118 Ga0466706_065936 3300042599 Bacteria 9827
119 Ga0466706_145847 3300042599 Bacteria 2378
120 Ga0466706_150379 3300042599 Unclassified 23702
121 Ga0466706_151904 3300042599 Bacteria 2485
122 Ga0466706_205990 3300042599 Unclassified 63346
123 Ga0466706_217022 3300042599 Unclassified 2028
124 Ga0466706_285786 3300042599 Unclassified 1771
125 Ga0466700_379778 3300042600 Bacteria 1014
126 Ga0466713_130289 3300042602 Bacteria 9656
127 Ga0466704_295438 3300042643 Bacteria 4615

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17864 AAA_lid_4 RuvB AAA lid domain 210 283 0.99
PF05496 RuvB_N Holliday junction DNA helicase RuvB P-loop domain 49 207 0.99
PF05491 RuvB_C RuvB C-terminal winged helix domain 285 354 0.98
PF00004 AAA ATPase family associated with various cellular activities (AAA) 84 208 0.95
PF07728 AAA_5 AAA domain (dynein-related subfamily) 83 201 0.88

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.