Protein Family IF05615

Metagenome Isolate
336 Members
126 Samples
259 Scaffolds
475.9 Avg Length

🧬 Representative Sequence

ID
3300042599|Ga0466706_119478|Ga0466706_119478_452_2062
Length
527 aa
Sequence
MHEASQKLFCKVFDQTFFKKFVGCGVKPHDLQPDAQSKKQEGTQVTLQNGTIPRDWKLERNLTMLMDFYELTMANGYFVGGVGDRVAVFDMFFRKIPENGGFSIFAGLEQLVNYLQNLSFTEEDVAFLRSKKVFDERFLCDVWAFKEGTPMFPGEPIVVVRGPVIQAQLVETMVLLTINHQSLIATKANRIVRAAEGRNVMEFGSRRAQSYDAAIYGARAAYIGGCSSTACTILERDYGVPAVGTMAHSWVQMFDSEYDAFVNYARLYPHSCTLLVDTYSTIKSGVPNAIRVFDEVLKPLGVRPKGIRIDSGDIAYLSKKARKMLDEAGYEDVSIVASNSLDEYIIRDLLIQGAKVDSFGVGEKLITSKAEPVMGGVYKLVAIEGADGDYVPKIKVSETVEKITNPGFKKAYRFFNRDTGKAIADYVAGYDEMVNPEEPVVLFDPAAVWKKKTVQHFDMQNLLEPIFIGGKCVYELPPLPEIQAYCMSQVDSLWDEVKRFEHPHRYYVDLSRELWDMKQDLLMKMEL

πŸ“Š Sample Types

Isolate 22.9%
Metagenome 77.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 42.6%
Termitidae 19.7%
Drosophilidae 11.5%
Kalotermitidae 9.8%
Termopsidae 3.3%
Rhinotermitidae 2.5%
Apidae 1.6%
Passalidae 1.6%
Noctuidae 1.6%
Tenebrionidae 0.8%
Stratiomyidae 0.8%
Hodotermitidae 0.8%
Scarabaeidae 0.8%
Penaeidae 0.8%
Formicidae 0.8%
Blattidae 0.8%

🌳 Taxonomy

Archaea 3
Bacteria 327
Eukaryota 0
Viruses 0
Unclassified 6

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
2 2590828840 Clostridium sp. 2 Isolate Termitidae
3 2820348946 Unclassified Firmicutes Nt197P3bin47 Isolate Unclassified
4 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
5 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
6 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
7 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
8 2820594669 Unclassified Firmicutes Emb289P1bin61 Isolate Unclassified
9 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
10 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
11 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
14 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
15 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
16 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
19 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
20 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
21 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
22 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
23 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
24 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
25 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
26 2627854132 Campylobacter peloridis LMG 23910 Isolate Unclassified
27 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
30 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
31 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
32 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
33 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
36 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
37 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
38 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
39 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
40 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
41 2870004507 Campylobacter coli 14983A Isolate Unclassified
42 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
43 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
44 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
45 2820229114 Unclassified Firmicutes Th196P4bin40 Isolate Unclassified
46 2820249082 Unclassified Firmicutes Th196P3bin69 Isolate Unclassified
47 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
48 2820364642 Unclassified Firmicutes Nt197P3bin107 Isolate Unclassified
49 2820518089 Unclassified Firmicutes Lab288P1bin27 Isolate Unclassified
50 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
51 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
52 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
53 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
54 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
55 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
56 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
57 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
58 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
59 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
60 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
61 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
62 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
63 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
64 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
65 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
66 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
67 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
68 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
69 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
70 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
71 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
72 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
73 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
74 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
75 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
76 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
77 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
78 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
79 8082023105 Niallia sp. Man26 Isolate Penaeidae
80 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
81 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
82 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
83 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
84 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
85 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
86 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
87 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
88 2820412446 Unclassified Firmicutes Lab288P4bin39 Isolate Unclassified
89 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
90 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
91 2035265002 Agrotis sp. gut microbial communities from Texas A and M University, USA Metagenome Noctuidae
92 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
93 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
94 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
95 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
96 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
97 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
98 3300003097 Cutworm gut microbial communities from Hangzhou, China Metagenome Noctuidae
99 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
100 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
101 2593339125 Clostridium sp. 5 Isolate Termitidae
102 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
103 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
104 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
105 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
106 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
107 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
108 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
109 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
110 2916858470 Heyndrickxia oleronia Isolate Unclassified
111 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
112 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
113 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
114 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
115 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
116 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
117 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
118 2820688768 Unclassified Firmicutes Co191P1bin74 Isolate Unclassified
119 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
120 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
121 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
122 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
123 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
124 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
125 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
126 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_343937 3300042612 Bacteria 5597
2 Ga0415639_015284 3300038395 Bacteria 19308
3 Ga0415639_016703 3300038395 Bacteria 7449
4 Ga0466696_006676 3300042596 Bacteria 3167
5 Ga0466696_147679 3300042596 Bacteria 4593
6 Ga0466700_210474 3300042600 Bacteria 75558
7 Ga0466707_257536 3300042601 Bacteria 9208
8 Ga0466716_118726 3300042605 Bacteria 5150
9 Ga0466723_046241 3300042618 Bacteria 4219
10 Ga0466723_341881 3300042618 Bacteria 1861
11 Ga0466726_084384 3300042619 Bacteria 28979
12 Ga0466735_097927 3300042624 Bacteria 15902
13 Ga0466703_058274 3300042636 Bacteria 13690
14 Ga0466703_348724 3300042636 Bacteria 2779
15 Ga0466704_035439 3300042643 Unclassified 8149
16 Ga0123356_10000625 3300010049 Bacteria 39070
17 Ga0123353_10014379 3300010167 Archaea 11403
18 Ga0123353_10071756 3300010167 Bacteria 5564
19 Ga0123353_10239763 3300010167 Bacteria 2818
20 Ga0123353_10446008 3300010167 Bacteria 1907
21 Ga0123354_10059110 3300010882 Bacteria 5689
22 Ga0123354_10093125 3300010882 Bacteria 4144
23 Ga0123354_10228769 3300010882 Bacteria 1951
24 JGI24703J35330_11732439 3300002501 Bacteria 2794
25 Ga0072941_1251597 3300005201 Bacteria 4313
26 Ga0466697_172194 3300042611 Bacteria 6427
27 Ga0562378_1008 3300056814 Bacteria 35411
28 Ga0466693_003806 3300042592 Bacteria 3719
29 Ga0466706_171720 3300042599 Bacteria 35884
30 Ga0466707_201517 3300042601 Bacteria 4192
31 Ga0466707_400789 3300042601 Bacteria 3520
32 Ga0466714_110370 3300042603 Bacteria 2338
33 Ga0466719_457907 3300042606 Bacteria 1974
34 Ga0466715_016274 3300042616 Bacteria 8909
35 Ga0466729_299660 3300042621 Bacteria 4404
36 Ga0466735_130279 3300042624 Bacteria 3786
37 Ga0466702_048059 3300042635 Bacteria 26549
38 Ga0466703_197391 3300042636 Bacteria 14762
39 Ga0466704_508916 3300042643 Bacteria 4525
40 Ga0123357_10008023 3300009784 Bacteria 13138
41 Ga0123357_10290931 3300009784 Bacteria 1669
42 Ga0123355_10207187 3300009826 Bacteria 2850
43 Ga0123356_10000477 3300010049 Bacteria 44821
44 Ga0123356_10015463 3300010049 Bacteria 7311
45 Ga0123356_10283099 3300010049 Bacteria 1754
46 Ga0123353_10000258 3300010167 Bacteria 67000
47 Ga0123353_10000910 3300010167 Bacteria 36084
48 Ga0123353_10012808 3300010167 Bacteria 11959
49 Ga0123353_10053811 3300010167 Bacteria 6433
50 Ga0123353_10121902 3300010167 Bacteria 4192
51 Ga0123353_10233453 3300010167 Bacteria 2865
52 Ga0123353_10329479 3300010167 Bacteria 2312
53 CwormDRAF_NODE_667_len_2813_cov_191_154633 2035265002 Bacteria 2843
54 IMNBL1DRAFT_c0000117 3300000062 Bacteria 71901
55 IMNBL1DRAFT_c0002205 3300000062 Bacteria 13737
56 JGI24703J35330_11748264 3300002501 Bacteria 12794
57 Ga0072941_1524157 3300005201 Bacteria 5541
58 Ga0102734_1000076 3300007129 Bacteria 30554
59 Ga0466696_280860 3300042596 Bacteria 4500
60 Ga0466707_148588 3300042601 Bacteria 7378
61 Ga0466707_180176 3300042601 Bacteria 19494
62 Ga0466722_110771 3300042609 Bacteria 3656
63 Ga0466705_463124 3300042612 Bacteria 3776
64 Ga0466705_493733 3300042612 Bacteria 32120
65 Ga0466715_081664 3300042616 Bacteria 54080
66 Ga0466728_335941 3300042620 Bacteria 9051
67 Ga0466734_077107 3300042623 Archaea 12506
68 Ga0466702_180104 3300042635 Bacteria 2852
69 Ga0466703_295322 3300042636 Bacteria 4420
70 Ga0123355_10081868 3300009826 Bacteria 5151
71 Ga0123356_10000037 3300010049 Bacteria 142433
72 Ga0123356_10006945 3300010049 Bacteria 11366
73 Ga0123356_10025952 3300010049 Bacteria 5508
74 Ga0123356_10062308 3300010049 Bacteria 3484
75 Ga0123353_10106755 3300010167 Bacteria 4512
76 Ga0123353_10262347 3300010167 Bacteria 2667
77 IMNBL1DRAFT_c0000022 3300000062 Bacteria 148036
78 IMNBL1DRAFT_c0002611 3300000062 Bacteria 12365
79 IMNBL1DRAFT_c0005371 3300000062 Bacteria 7348
80 JGI24702J35022_10000153 3300002462 Bacteria 35578
81 JGI24703J35330_11746691 3300002501 Bacteria 5525
82 Ga0466705_301271 3300042612 Bacteria 4918
83 Ga0415639_004471 3300038395 Bacteria 6771
84 Ga0466696_298449 3300042596 Bacteria 2180
85 Ga0466696_390510 3300042596 Bacteria 2828
86 Ga0466700_330717 3300042600 Bacteria 2846
87 Ga0466707_142854 3300042601 Bacteria 11637
88 Ga0466707_230506 3300042601 Bacteria 5943
89 Ga0466713_141505 3300042602 Bacteria 2856
90 Ga0466719_404444 3300042606 Bacteria 6265
91 Ga0466721_257503 3300042608 Bacteria 17185
92 Ga0466722_094428 3300042609 Bacteria 2035
93 Ga0466711_432353 3300042615 Bacteria 18247
94 Ga0466715_091678 3300042616 Bacteria 5138
95 Ga0466735_085913 3300042624 Unclassified 3547
96 Ga0466704_032929 3300042643 Bacteria 2069
97 Ga0466704_480481 3300042643 Bacteria 18722
98 Ga0466708_083499 3300042652 Bacteria 12587
99 Ga0466708_160390 3300042652 Bacteria 8842
100 Ga0123355_10005727 3300009826 Bacteria 18260
101 Ga0123356_10126110 3300010049 Archaea 2499
102 Ga0123353_10001247 3300010167 Bacteria 31195
103 Ga0123353_10008038 3300010167 Bacteria 14354
104 Ga0123353_10014279 3300010167 Bacteria 11439
105 Ga0123353_10087606 3300010167 Bacteria 5015
106 Ga0123353_10143956 3300010167 Bacteria 3814
107 Ga0123353_10175122 3300010167 Bacteria 3402
108 Ga0123353_10228135 3300010167 Bacteria 2906
109 Ga0123354_10055780 3300010882 Bacteria 5908
110 Ga0123354_10186634 3300010882 Bacteria 2342
111 Ga0123354_10241306 3300010882 Bacteria 1858
112 2227083609 2225789004 Bacteria 9990
113 2227510758 2225789004 Bacteria 18314
114 IMNBL1DRAFT_c0004373 3300000062 Bacteria 8525
115 JGI24702J35022_10006350 3300002462 Bacteria 6834
116 JGI24703J35330_11748747 3300002501 Bacteria 30882
117 Ga0068305_10023092 3300005083 Bacteria 5247
118 Ga0466705_095675 3300042612 Bacteria 277468
119 Ga0466733_149488 3300042659 Bacteria 3803
120 Ga0466733_187054 3300042659 Bacteria 3718
121 Ga0466691_157615 3300042593 Bacteria 1535
122 Ga0466706_138852 3300042599 Bacteria 93255
123 Ga0466706_279466 3300042599 Bacteria 2098
124 Ga0466717_049315 3300042604 Bacteria 2112
125 Ga0466719_233762 3300042606 Bacteria 9801
126 Ga0466723_013469 3300042618 Bacteria 5425
127 Ga0466735_004931 3300042624 Bacteria 27300
128 Ga0466703_322974 3300042636 Bacteria 10932
129 Ga0466727_034949 3300042655 Bacteria 4134
130 Ga0466727_239196 3300042655 Bacteria 11634
131 Ga0123356_10013543 3300010049 Bacteria 7864
132 Ga0123356_10160195 3300010049 Bacteria 2247
133 Ga0123353_10002749 3300010167 Bacteria 21952
134 Ga0123353_10050878 3300010167 Bacteria 6610
135 Ga0123353_10055827 3300010167 Bacteria 6320
136 Ga0123353_10059258 3300010167 Bacteria 6138
137 Ga0123353_10062861 3300010167 Bacteria 5954
138 Ga0123353_10065659 3300010167 Bacteria 5826
139 Ga0123353_10100664 3300010167 Bacteria 4658
140 Ga0123353_10334396 3300010167 Bacteria 2291
141 Ga0123353_10468374 3300010167 Unclassified 1848
142 2227080779 2225789004 Bacteria 173520
143 IMNBL1DRAFT_c0000413 3300000062 Bacteria 36160
144 JGI24702J35022_10001043 3300002462 Bacteria 17321
145 Ga0068302_10052705 3300005071 Bacteria 7254
146 Ga0466705_100368 3300042612 Bacteria 27602
147 Ga0466705_223657 3300042612 Bacteria 8232
148 Ga0415639_006490 3300038395 Bacteria 35011
149 Ga0466692_109783 3300042591 Bacteria 19456
150 Ga0466696_478070 3300042596 Bacteria 7532
151 Ga0466706_119478 3300042599 Bacteria 3620
152 Ga0466706_219961 3300042599 Bacteria 7128
153 Ga0466707_145331 3300042601 Bacteria 12330
154 Ga0466707_298598 3300042601 Bacteria 65618
155 Ga0466713_084836 3300042602 Bacteria 7481
156 Ga0466713_126050 3300042602 Bacteria 7816
157 Ga0466719_224386 3300042606 Bacteria 3965
158 Ga0466705_428272 3300042612 Bacteria 8791
159 Ga0466711_095198 3300042615 Bacteria 7784
160 Ga0466711_097566 3300042615 Bacteria 5069
161 Ga0466711_315488 3300042615 Bacteria 4201
162 Ga0466723_017119 3300042618 Bacteria 4709
163 Ga0466726_269220 3300042619 Bacteria 9599
164 Ga0466735_096107 3300042624 Bacteria 8495
165 Ga0466703_125883 3300042636 Bacteria 5997
166 Ga0466704_032009 3300042643 Unclassified 2263
167 Ga0466704_061562 3300042643 Bacteria 1837
168 Ga0466704_563232 3300042643 Bacteria 2851
169 Ga0466708_321961 3300042652 Bacteria 10654
170 Ga0123355_10002087 3300009826 Bacteria 28211
171 Ga0123355_10010764 3300009826 Bacteria 14057
172 Ga0123355_10038176 3300009826 Bacteria 7809
173 Ga0123355_10039908 3300009826 Bacteria 7641
174 Ga0123356_10204971 3300010049 Bacteria 2015
175 Ga0123356_10264004 3300010049 Bacteria 1807
176 Ga0123356_10331711 3300010049 Bacteria 1638
177 Ga0123353_10044315 3300010167 Bacteria 7052
178 Ga0123353_10065213 3300010167 Bacteria 5846
179 Ga0123353_10088485 3300010167 Bacteria 4987
180 Ga0123353_10233892 3300010167 Bacteria 2862
181 Ga0123353_10673237 3300010167 Bacteria 1459
182 2227505190 2225789004 Bacteria 3703
183 IMNBL1DRAFT_c0004668 3300000062 Bacteria 8127
184 JGI24700J35501_10930815 3300002508 Bacteria 25416
185 Ga0052191_103791 3300003097 Unclassified 2843
186 Ga0466705_105776 3300042612 Bacteria 17248
187 Ga0415639_010706 3300038395 Bacteria 3685
188 Ga0415639_030794 3300038395 Bacteria 4094
189 Ga0415639_209927 3300038395 Bacteria 3175
190 Ga0466692_004119 3300042591 Bacteria 15497
191 Ga0466691_045996 3300042593 Bacteria 2027
192 Ga0466696_384360 3300042596 Bacteria 5350
193 Ga0466706_128389 3300042599 Bacteria 3649
194 Ga0466707_216150 3300042601 Bacteria 6839
195 Ga0466713_045730 3300042602 Bacteria 108789
196 Ga0466714_019692 3300042603 Bacteria 2571
197 Ga0466719_286446 3300042606 Bacteria 42946
198 Ga0466719_439475 3300042606 Bacteria 1894
199 Ga0466711_207875 3300042615 Bacteria 9954
200 Ga0123355_10002291 3300009826 Bacteria 27062
201 Ga0123355_10061111 3300009826 Bacteria 6084
202 Ga0123355_10085809 3300009826 Unclassified 5008
203 Ga0123356_10001910 3300010049 Bacteria 22568
204 Ga0123356_10020322 3300010049 Bacteria 6285
205 Ga0123356_10171514 3300010049 Bacteria 2181
206 Ga0123353_10004166 3300010167 Bacteria 18553
207 Ga0123353_10036214 3300010167 Bacteria 7728
208 Ga0123353_10072345 3300010167 Bacteria 5540
209 Ga0123353_10309183 3300010167 Bacteria 2407
210 Ga0123353_10319121 3300010167 Bacteria 2359
211 Ga0123353_10386118 3300010167 Bacteria 2092
212 Ga0123353_10483555 3300010167 Bacteria 1811
213 2227469070 2225789004 Bacteria 24162
214 2227471857 2225789004 Bacteria 23246
215 2227497971 2225789004 Bacteria 3879
216 JGI24702J35022_10003015 3300002462 Bacteria 10185
217 JGI24702J35022_10059778 3300002462 Bacteria 2036
218 JGI24703J35330_11747352 3300002501 Bacteria 6643
219 Ga0466733_092422 3300042659 Bacteria 15292
220 Ga0415639_000924 3300038395 Bacteria 51434
221 Ga0415639_008617 3300038395 Bacteria 23471
222 Ga0415639_109676 3300038395 Bacteria 3192
223 Ga0466693_304591 3300042592 Bacteria 4139
224 Ga0466707_046501 3300042601 Bacteria 3131
225 Ga0466707_050190 3300042601 Bacteria 7033
226 Ga0466713_084877 3300042602 Bacteria 7481
227 Ga0466713_099282 3300042602 Bacteria 8623
228 Ga0466713_122100 3300042602 Bacteria 19669
229 Ga0466714_029679 3300042603 Bacteria 2513
230 Ga0466721_056897 3300042608 Bacteria 15406
231 Ga0466722_245718 3300042609 Bacteria 6417
232 Ga0466711_088104 3300042615 Bacteria 2106
233 Ga0466723_126889 3300042618 Bacteria 2166
234 Ga0466729_008059 3300042621 Bacteria 10688
235 Ga0466731_027954 3300042622 Bacteria 3939
236 Ga0466735_074267 3300042624 Bacteria 99444
237 Ga0466702_125540 3300042635 Bacteria 1775
238 Ga0466703_407782 3300042636 Bacteria 5240
239 Ga0466704_319025 3300042643 Bacteria 3680
240 Ga0123357_10005559 3300009784 Bacteria 15127
241 Ga0123357_10112696 3300009784 Bacteria 3460
242 Ga0123355_10001594 3300009826 Bacteria 31632
243 Ga0123355_10004379 3300009826 Bacteria 20539
244 Ga0123355_10008966 3300009826 Bacteria 15156
245 Ga0123355_10016482 3300009826 Bacteria 11646
246 Ga0123355_10085205 3300009826 Bacteria 5030
247 Ga0123355_10114031 3300009826 Bacteria 4214
248 Ga0123356_10017358 3300010049 Bacteria 6847
249 Ga0123356_10021635 3300010049 Bacteria 6069
250 Ga0123356_10036865 3300010049 Bacteria 4564
251 Ga0123353_10241985 3300010167 Bacteria 2803
252 Ga0123353_10293700 3300010167 Bacteria 2486
253 Ga0123353_10421570 3300010167 Bacteria 1977
254 Ga0123353_10598990 3300010167 Bacteria 1576
255 Ga0123354_10005771 3300010882 Bacteria 18135
256 2227303007 2225789004 Bacteria 29314
257 IMNBL1DRAFT_c0000094 3300000062 Bacteria 77788
258 JGI24705J35276_12217967 3300002504 Bacteria 2120
259 Ga0072941_1019039 3300005201 Bacteria 32748

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17956 NAPRTase_C Nicotinate phosphoribosyltransferase C-terminal domain 409 518 0.98
PF17767 NAPRTase_N Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain 64 179 0.97
PF02749 QRPTase_N Quinolinate phosphoribosyl transferase, N-terminal domain 132 182 0.84
PF04095 NAPRTase Nicotinate phosphoribosyltransferase (NAPRTase) family 200 379 0.77

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02749 GO:0016763 pentosyltransferase activity MF

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.