Protein Family IF05615
Metagenome
Isolate
336
Members
126
Samples
259
Scaffolds
475.9
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_119478|Ga0466706_119478_452_2062
- Length
- 527 aa
- Sequence
- MHEASQKLFCKVFDQTFFKKFVGCGVKPHDLQPDAQSKKQEGTQVTLQNGTIPRDWKLERNLTMLMDFYELTMANGYFVGGVGDRVAVFDMFFRKIPENGGFSIFAGLEQLVNYLQNLSFTEEDVAFLRSKKVFDERFLCDVWAFKEGTPMFPGEPIVVVRGPVIQAQLVETMVLLTINHQSLIATKANRIVRAAEGRNVMEFGSRRAQSYDAAIYGARAAYIGGCSSTACTILERDYGVPAVGTMAHSWVQMFDSEYDAFVNYARLYPHSCTLLVDTYSTIKSGVPNAIRVFDEVLKPLGVRPKGIRIDSGDIAYLSKKARKMLDEAGYEDVSIVASNSLDEYIIRDLLIQGAKVDSFGVGEKLITSKAEPVMGGVYKLVAIEGADGDYVPKIKVSETVEKITNPGFKKAYRFFNRDTGKAIADYVAGYDEMVNPEEPVVLFDPAAVWKKKTVQHFDMQNLLEPIFIGGKCVYELPPLPEIQAYCMSQVDSLWDEVKRFEHPHRYYVDLSRELWDMKQDLLMKMEL
Sample Types
Isolate
22.9%
Metagenome
77.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
42.6%
Termitidae
19.7%
Drosophilidae
11.5%
Kalotermitidae
9.8%
Termopsidae
3.3%
Rhinotermitidae
2.5%
Apidae
1.6%
Passalidae
1.6%
Noctuidae
1.6%
Tenebrionidae
0.8%
Stratiomyidae
0.8%
Hodotermitidae
0.8%
Scarabaeidae
0.8%
Penaeidae
0.8%
Formicidae
0.8%
Blattidae
0.8%
Taxonomy
Archaea
3
Bacteria
327
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 2 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 3 | 2820348946 | Unclassified Firmicutes Nt197P3bin47 | Isolate | Unclassified |
| 4 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 5 | 2820477775 | Unclassified Firmicutes Lab288P1bin79 | Isolate | Unclassified |
| 6 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 7 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 8 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 11 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 8017458139 | Lactobacillus johnsonii CRL1647 | Isolate | Apidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 19 | 2960772748 | Lactiplantibacillus plantarum MHO2.9 | Isolate | |
| 20 | 2964765680 | Lactiplantibacillus plantarum MHO2.5 | Isolate | |
| 21 | 2937236879 | Lactiplantibacillus plantarum MHO2.4 | Isolate | |
| 22 | 2576861670 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 23 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 24 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 25 | 2820447167 | Unclassified Firmicutes Lab288P3bin192 | Isolate | Unclassified |
| 26 | 2627854132 | Campylobacter peloridis LMG 23910 | Isolate | Unclassified |
| 27 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 30 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 31 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 32 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 33 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 34 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 35 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 36 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 37 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 41 | 2870004507 | Campylobacter coli 14983A | Isolate | Unclassified |
| 42 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 43 | 2728369362 | Lactiplantibacillus plantarum DF | Isolate | Drosophilidae |
| 44 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 45 | 2820229114 | Unclassified Firmicutes Th196P4bin40 | Isolate | Unclassified |
| 46 | 2820249082 | Unclassified Firmicutes Th196P3bin69 | Isolate | Unclassified |
| 47 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 48 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 49 | 2820518089 | Unclassified Firmicutes Lab288P1bin27 | Isolate | Unclassified |
| 50 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 51 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 52 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 53 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 54 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 55 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 56 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 57 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 58 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 59 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 60 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 61 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 62 | 2820525019 | Unclassified Firmicutes Lab288P1bin2 | Isolate | Unclassified |
| 63 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 64 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 65 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 66 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 67 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 68 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 69 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 70 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 71 | 2690315820 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 72 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 73 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 74 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 75 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 76 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 77 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 78 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 79 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 80 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 81 | 2758568557 | Bombilactobacillus mellis ESL0394 | Isolate | Unclassified |
| 82 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 83 | 2770939318 | Lactiplantibacillus plantarum plantarum LP2 | Isolate | Apidae |
| 84 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 85 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 86 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 87 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 88 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 89 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 90 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 91 | 2035265002 | Agrotis sp. gut microbial communities from Texas A and M University, USA | Metagenome | Noctuidae |
| 92 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 93 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 94 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 95 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 96 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 97 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 98 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 99 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 100 | 2957623355 | Lactiplantibacillus plantarum FlyG11.1.2 | Isolate | Drosophilidae |
| 101 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 102 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 103 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 104 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 105 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 106 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 107 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 108 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 109 | 2902668162 | Lacticaseibacillus paracasei DmW_181 | Isolate | Drosophilidae |
| 110 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 111 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 112 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 113 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 114 | 2718218475 | Lactiplantibacillus plantarum KP | Isolate | Drosophilidae |
| 115 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 116 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 117 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 118 | 2820688768 | Unclassified Firmicutes Co191P1bin74 | Isolate | Unclassified |
| 119 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 120 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 121 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 122 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 123 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 124 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 125 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 126 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_343937 | 3300042612 | Bacteria | 5597 |
| 2 | Ga0415639_015284 | 3300038395 | Bacteria | 19308 |
| 3 | Ga0415639_016703 | 3300038395 | Bacteria | 7449 |
| 4 | Ga0466696_006676 | 3300042596 | Bacteria | 3167 |
| 5 | Ga0466696_147679 | 3300042596 | Bacteria | 4593 |
| 6 | Ga0466700_210474 | 3300042600 | Bacteria | 75558 |
| 7 | Ga0466707_257536 | 3300042601 | Bacteria | 9208 |
| 8 | Ga0466716_118726 | 3300042605 | Bacteria | 5150 |
| 9 | Ga0466723_046241 | 3300042618 | Bacteria | 4219 |
| 10 | Ga0466723_341881 | 3300042618 | Bacteria | 1861 |
| 11 | Ga0466726_084384 | 3300042619 | Bacteria | 28979 |
| 12 | Ga0466735_097927 | 3300042624 | Bacteria | 15902 |
| 13 | Ga0466703_058274 | 3300042636 | Bacteria | 13690 |
| 14 | Ga0466703_348724 | 3300042636 | Bacteria | 2779 |
| 15 | Ga0466704_035439 | 3300042643 | Unclassified | 8149 |
| 16 | Ga0123356_10000625 | 3300010049 | Bacteria | 39070 |
| 17 | Ga0123353_10014379 | 3300010167 | Archaea | 11403 |
| 18 | Ga0123353_10071756 | 3300010167 | Bacteria | 5564 |
| 19 | Ga0123353_10239763 | 3300010167 | Bacteria | 2818 |
| 20 | Ga0123353_10446008 | 3300010167 | Bacteria | 1907 |
| 21 | Ga0123354_10059110 | 3300010882 | Bacteria | 5689 |
| 22 | Ga0123354_10093125 | 3300010882 | Bacteria | 4144 |
| 23 | Ga0123354_10228769 | 3300010882 | Bacteria | 1951 |
| 24 | JGI24703J35330_11732439 | 3300002501 | Bacteria | 2794 |
| 25 | Ga0072941_1251597 | 3300005201 | Bacteria | 4313 |
| 26 | Ga0466697_172194 | 3300042611 | Bacteria | 6427 |
| 27 | Ga0562378_1008 | 3300056814 | Bacteria | 35411 |
| 28 | Ga0466693_003806 | 3300042592 | Bacteria | 3719 |
| 29 | Ga0466706_171720 | 3300042599 | Bacteria | 35884 |
| 30 | Ga0466707_201517 | 3300042601 | Bacteria | 4192 |
| 31 | Ga0466707_400789 | 3300042601 | Bacteria | 3520 |
| 32 | Ga0466714_110370 | 3300042603 | Bacteria | 2338 |
| 33 | Ga0466719_457907 | 3300042606 | Bacteria | 1974 |
| 34 | Ga0466715_016274 | 3300042616 | Bacteria | 8909 |
| 35 | Ga0466729_299660 | 3300042621 | Bacteria | 4404 |
| 36 | Ga0466735_130279 | 3300042624 | Bacteria | 3786 |
| 37 | Ga0466702_048059 | 3300042635 | Bacteria | 26549 |
| 38 | Ga0466703_197391 | 3300042636 | Bacteria | 14762 |
| 39 | Ga0466704_508916 | 3300042643 | Bacteria | 4525 |
| 40 | Ga0123357_10008023 | 3300009784 | Bacteria | 13138 |
| 41 | Ga0123357_10290931 | 3300009784 | Bacteria | 1669 |
| 42 | Ga0123355_10207187 | 3300009826 | Bacteria | 2850 |
| 43 | Ga0123356_10000477 | 3300010049 | Bacteria | 44821 |
| 44 | Ga0123356_10015463 | 3300010049 | Bacteria | 7311 |
| 45 | Ga0123356_10283099 | 3300010049 | Bacteria | 1754 |
| 46 | Ga0123353_10000258 | 3300010167 | Bacteria | 67000 |
| 47 | Ga0123353_10000910 | 3300010167 | Bacteria | 36084 |
| 48 | Ga0123353_10012808 | 3300010167 | Bacteria | 11959 |
| 49 | Ga0123353_10053811 | 3300010167 | Bacteria | 6433 |
| 50 | Ga0123353_10121902 | 3300010167 | Bacteria | 4192 |
| 51 | Ga0123353_10233453 | 3300010167 | Bacteria | 2865 |
| 52 | Ga0123353_10329479 | 3300010167 | Bacteria | 2312 |
| 53 | CwormDRAF_NODE_667_len_2813_cov_191_154633 | 2035265002 | Bacteria | 2843 |
| 54 | IMNBL1DRAFT_c0000117 | 3300000062 | Bacteria | 71901 |
| 55 | IMNBL1DRAFT_c0002205 | 3300000062 | Bacteria | 13737 |
| 56 | JGI24703J35330_11748264 | 3300002501 | Bacteria | 12794 |
| 57 | Ga0072941_1524157 | 3300005201 | Bacteria | 5541 |
| 58 | Ga0102734_1000076 | 3300007129 | Bacteria | 30554 |
| 59 | Ga0466696_280860 | 3300042596 | Bacteria | 4500 |
| 60 | Ga0466707_148588 | 3300042601 | Bacteria | 7378 |
| 61 | Ga0466707_180176 | 3300042601 | Bacteria | 19494 |
| 62 | Ga0466722_110771 | 3300042609 | Bacteria | 3656 |
| 63 | Ga0466705_463124 | 3300042612 | Bacteria | 3776 |
| 64 | Ga0466705_493733 | 3300042612 | Bacteria | 32120 |
| 65 | Ga0466715_081664 | 3300042616 | Bacteria | 54080 |
| 66 | Ga0466728_335941 | 3300042620 | Bacteria | 9051 |
| 67 | Ga0466734_077107 | 3300042623 | Archaea | 12506 |
| 68 | Ga0466702_180104 | 3300042635 | Bacteria | 2852 |
| 69 | Ga0466703_295322 | 3300042636 | Bacteria | 4420 |
| 70 | Ga0123355_10081868 | 3300009826 | Bacteria | 5151 |
| 71 | Ga0123356_10000037 | 3300010049 | Bacteria | 142433 |
| 72 | Ga0123356_10006945 | 3300010049 | Bacteria | 11366 |
| 73 | Ga0123356_10025952 | 3300010049 | Bacteria | 5508 |
| 74 | Ga0123356_10062308 | 3300010049 | Bacteria | 3484 |
| 75 | Ga0123353_10106755 | 3300010167 | Bacteria | 4512 |
| 76 | Ga0123353_10262347 | 3300010167 | Bacteria | 2667 |
| 77 | IMNBL1DRAFT_c0000022 | 3300000062 | Bacteria | 148036 |
| 78 | IMNBL1DRAFT_c0002611 | 3300000062 | Bacteria | 12365 |
| 79 | IMNBL1DRAFT_c0005371 | 3300000062 | Bacteria | 7348 |
| 80 | JGI24702J35022_10000153 | 3300002462 | Bacteria | 35578 |
| 81 | JGI24703J35330_11746691 | 3300002501 | Bacteria | 5525 |
| 82 | Ga0466705_301271 | 3300042612 | Bacteria | 4918 |
| 83 | Ga0415639_004471 | 3300038395 | Bacteria | 6771 |
| 84 | Ga0466696_298449 | 3300042596 | Bacteria | 2180 |
| 85 | Ga0466696_390510 | 3300042596 | Bacteria | 2828 |
| 86 | Ga0466700_330717 | 3300042600 | Bacteria | 2846 |
| 87 | Ga0466707_142854 | 3300042601 | Bacteria | 11637 |
| 88 | Ga0466707_230506 | 3300042601 | Bacteria | 5943 |
| 89 | Ga0466713_141505 | 3300042602 | Bacteria | 2856 |
| 90 | Ga0466719_404444 | 3300042606 | Bacteria | 6265 |
| 91 | Ga0466721_257503 | 3300042608 | Bacteria | 17185 |
| 92 | Ga0466722_094428 | 3300042609 | Bacteria | 2035 |
| 93 | Ga0466711_432353 | 3300042615 | Bacteria | 18247 |
| 94 | Ga0466715_091678 | 3300042616 | Bacteria | 5138 |
| 95 | Ga0466735_085913 | 3300042624 | Unclassified | 3547 |
| 96 | Ga0466704_032929 | 3300042643 | Bacteria | 2069 |
| 97 | Ga0466704_480481 | 3300042643 | Bacteria | 18722 |
| 98 | Ga0466708_083499 | 3300042652 | Bacteria | 12587 |
| 99 | Ga0466708_160390 | 3300042652 | Bacteria | 8842 |
| 100 | Ga0123355_10005727 | 3300009826 | Bacteria | 18260 |
| 101 | Ga0123356_10126110 | 3300010049 | Archaea | 2499 |
| 102 | Ga0123353_10001247 | 3300010167 | Bacteria | 31195 |
| 103 | Ga0123353_10008038 | 3300010167 | Bacteria | 14354 |
| 104 | Ga0123353_10014279 | 3300010167 | Bacteria | 11439 |
| 105 | Ga0123353_10087606 | 3300010167 | Bacteria | 5015 |
| 106 | Ga0123353_10143956 | 3300010167 | Bacteria | 3814 |
| 107 | Ga0123353_10175122 | 3300010167 | Bacteria | 3402 |
| 108 | Ga0123353_10228135 | 3300010167 | Bacteria | 2906 |
| 109 | Ga0123354_10055780 | 3300010882 | Bacteria | 5908 |
| 110 | Ga0123354_10186634 | 3300010882 | Bacteria | 2342 |
| 111 | Ga0123354_10241306 | 3300010882 | Bacteria | 1858 |
| 112 | 2227083609 | 2225789004 | Bacteria | 9990 |
| 113 | 2227510758 | 2225789004 | Bacteria | 18314 |
| 114 | IMNBL1DRAFT_c0004373 | 3300000062 | Bacteria | 8525 |
| 115 | JGI24702J35022_10006350 | 3300002462 | Bacteria | 6834 |
| 116 | JGI24703J35330_11748747 | 3300002501 | Bacteria | 30882 |
| 117 | Ga0068305_10023092 | 3300005083 | Bacteria | 5247 |
| 118 | Ga0466705_095675 | 3300042612 | Bacteria | 277468 |
| 119 | Ga0466733_149488 | 3300042659 | Bacteria | 3803 |
| 120 | Ga0466733_187054 | 3300042659 | Bacteria | 3718 |
| 121 | Ga0466691_157615 | 3300042593 | Bacteria | 1535 |
| 122 | Ga0466706_138852 | 3300042599 | Bacteria | 93255 |
| 123 | Ga0466706_279466 | 3300042599 | Bacteria | 2098 |
| 124 | Ga0466717_049315 | 3300042604 | Bacteria | 2112 |
| 125 | Ga0466719_233762 | 3300042606 | Bacteria | 9801 |
| 126 | Ga0466723_013469 | 3300042618 | Bacteria | 5425 |
| 127 | Ga0466735_004931 | 3300042624 | Bacteria | 27300 |
| 128 | Ga0466703_322974 | 3300042636 | Bacteria | 10932 |
| 129 | Ga0466727_034949 | 3300042655 | Bacteria | 4134 |
| 130 | Ga0466727_239196 | 3300042655 | Bacteria | 11634 |
| 131 | Ga0123356_10013543 | 3300010049 | Bacteria | 7864 |
| 132 | Ga0123356_10160195 | 3300010049 | Bacteria | 2247 |
| 133 | Ga0123353_10002749 | 3300010167 | Bacteria | 21952 |
| 134 | Ga0123353_10050878 | 3300010167 | Bacteria | 6610 |
| 135 | Ga0123353_10055827 | 3300010167 | Bacteria | 6320 |
| 136 | Ga0123353_10059258 | 3300010167 | Bacteria | 6138 |
| 137 | Ga0123353_10062861 | 3300010167 | Bacteria | 5954 |
| 138 | Ga0123353_10065659 | 3300010167 | Bacteria | 5826 |
| 139 | Ga0123353_10100664 | 3300010167 | Bacteria | 4658 |
| 140 | Ga0123353_10334396 | 3300010167 | Bacteria | 2291 |
| 141 | Ga0123353_10468374 | 3300010167 | Unclassified | 1848 |
| 142 | 2227080779 | 2225789004 | Bacteria | 173520 |
| 143 | IMNBL1DRAFT_c0000413 | 3300000062 | Bacteria | 36160 |
| 144 | JGI24702J35022_10001043 | 3300002462 | Bacteria | 17321 |
| 145 | Ga0068302_10052705 | 3300005071 | Bacteria | 7254 |
| 146 | Ga0466705_100368 | 3300042612 | Bacteria | 27602 |
| 147 | Ga0466705_223657 | 3300042612 | Bacteria | 8232 |
| 148 | Ga0415639_006490 | 3300038395 | Bacteria | 35011 |
| 149 | Ga0466692_109783 | 3300042591 | Bacteria | 19456 |
| 150 | Ga0466696_478070 | 3300042596 | Bacteria | 7532 |
| 151 | Ga0466706_119478 | 3300042599 | Bacteria | 3620 |
| 152 | Ga0466706_219961 | 3300042599 | Bacteria | 7128 |
| 153 | Ga0466707_145331 | 3300042601 | Bacteria | 12330 |
| 154 | Ga0466707_298598 | 3300042601 | Bacteria | 65618 |
| 155 | Ga0466713_084836 | 3300042602 | Bacteria | 7481 |
| 156 | Ga0466713_126050 | 3300042602 | Bacteria | 7816 |
| 157 | Ga0466719_224386 | 3300042606 | Bacteria | 3965 |
| 158 | Ga0466705_428272 | 3300042612 | Bacteria | 8791 |
| 159 | Ga0466711_095198 | 3300042615 | Bacteria | 7784 |
| 160 | Ga0466711_097566 | 3300042615 | Bacteria | 5069 |
| 161 | Ga0466711_315488 | 3300042615 | Bacteria | 4201 |
| 162 | Ga0466723_017119 | 3300042618 | Bacteria | 4709 |
| 163 | Ga0466726_269220 | 3300042619 | Bacteria | 9599 |
| 164 | Ga0466735_096107 | 3300042624 | Bacteria | 8495 |
| 165 | Ga0466703_125883 | 3300042636 | Bacteria | 5997 |
| 166 | Ga0466704_032009 | 3300042643 | Unclassified | 2263 |
| 167 | Ga0466704_061562 | 3300042643 | Bacteria | 1837 |
| 168 | Ga0466704_563232 | 3300042643 | Bacteria | 2851 |
| 169 | Ga0466708_321961 | 3300042652 | Bacteria | 10654 |
| 170 | Ga0123355_10002087 | 3300009826 | Bacteria | 28211 |
| 171 | Ga0123355_10010764 | 3300009826 | Bacteria | 14057 |
| 172 | Ga0123355_10038176 | 3300009826 | Bacteria | 7809 |
| 173 | Ga0123355_10039908 | 3300009826 | Bacteria | 7641 |
| 174 | Ga0123356_10204971 | 3300010049 | Bacteria | 2015 |
| 175 | Ga0123356_10264004 | 3300010049 | Bacteria | 1807 |
| 176 | Ga0123356_10331711 | 3300010049 | Bacteria | 1638 |
| 177 | Ga0123353_10044315 | 3300010167 | Bacteria | 7052 |
| 178 | Ga0123353_10065213 | 3300010167 | Bacteria | 5846 |
| 179 | Ga0123353_10088485 | 3300010167 | Bacteria | 4987 |
| 180 | Ga0123353_10233892 | 3300010167 | Bacteria | 2862 |
| 181 | Ga0123353_10673237 | 3300010167 | Bacteria | 1459 |
| 182 | 2227505190 | 2225789004 | Bacteria | 3703 |
| 183 | IMNBL1DRAFT_c0004668 | 3300000062 | Bacteria | 8127 |
| 184 | JGI24700J35501_10930815 | 3300002508 | Bacteria | 25416 |
| 185 | Ga0052191_103791 | 3300003097 | Unclassified | 2843 |
| 186 | Ga0466705_105776 | 3300042612 | Bacteria | 17248 |
| 187 | Ga0415639_010706 | 3300038395 | Bacteria | 3685 |
| 188 | Ga0415639_030794 | 3300038395 | Bacteria | 4094 |
| 189 | Ga0415639_209927 | 3300038395 | Bacteria | 3175 |
| 190 | Ga0466692_004119 | 3300042591 | Bacteria | 15497 |
| 191 | Ga0466691_045996 | 3300042593 | Bacteria | 2027 |
| 192 | Ga0466696_384360 | 3300042596 | Bacteria | 5350 |
| 193 | Ga0466706_128389 | 3300042599 | Bacteria | 3649 |
| 194 | Ga0466707_216150 | 3300042601 | Bacteria | 6839 |
| 195 | Ga0466713_045730 | 3300042602 | Bacteria | 108789 |
| 196 | Ga0466714_019692 | 3300042603 | Bacteria | 2571 |
| 197 | Ga0466719_286446 | 3300042606 | Bacteria | 42946 |
| 198 | Ga0466719_439475 | 3300042606 | Bacteria | 1894 |
| 199 | Ga0466711_207875 | 3300042615 | Bacteria | 9954 |
| 200 | Ga0123355_10002291 | 3300009826 | Bacteria | 27062 |
| 201 | Ga0123355_10061111 | 3300009826 | Bacteria | 6084 |
| 202 | Ga0123355_10085809 | 3300009826 | Unclassified | 5008 |
| 203 | Ga0123356_10001910 | 3300010049 | Bacteria | 22568 |
| 204 | Ga0123356_10020322 | 3300010049 | Bacteria | 6285 |
| 205 | Ga0123356_10171514 | 3300010049 | Bacteria | 2181 |
| 206 | Ga0123353_10004166 | 3300010167 | Bacteria | 18553 |
| 207 | Ga0123353_10036214 | 3300010167 | Bacteria | 7728 |
| 208 | Ga0123353_10072345 | 3300010167 | Bacteria | 5540 |
| 209 | Ga0123353_10309183 | 3300010167 | Bacteria | 2407 |
| 210 | Ga0123353_10319121 | 3300010167 | Bacteria | 2359 |
| 211 | Ga0123353_10386118 | 3300010167 | Bacteria | 2092 |
| 212 | Ga0123353_10483555 | 3300010167 | Bacteria | 1811 |
| 213 | 2227469070 | 2225789004 | Bacteria | 24162 |
| 214 | 2227471857 | 2225789004 | Bacteria | 23246 |
| 215 | 2227497971 | 2225789004 | Bacteria | 3879 |
| 216 | JGI24702J35022_10003015 | 3300002462 | Bacteria | 10185 |
| 217 | JGI24702J35022_10059778 | 3300002462 | Bacteria | 2036 |
| 218 | JGI24703J35330_11747352 | 3300002501 | Bacteria | 6643 |
| 219 | Ga0466733_092422 | 3300042659 | Bacteria | 15292 |
| 220 | Ga0415639_000924 | 3300038395 | Bacteria | 51434 |
| 221 | Ga0415639_008617 | 3300038395 | Bacteria | 23471 |
| 222 | Ga0415639_109676 | 3300038395 | Bacteria | 3192 |
| 223 | Ga0466693_304591 | 3300042592 | Bacteria | 4139 |
| 224 | Ga0466707_046501 | 3300042601 | Bacteria | 3131 |
| 225 | Ga0466707_050190 | 3300042601 | Bacteria | 7033 |
| 226 | Ga0466713_084877 | 3300042602 | Bacteria | 7481 |
| 227 | Ga0466713_099282 | 3300042602 | Bacteria | 8623 |
| 228 | Ga0466713_122100 | 3300042602 | Bacteria | 19669 |
| 229 | Ga0466714_029679 | 3300042603 | Bacteria | 2513 |
| 230 | Ga0466721_056897 | 3300042608 | Bacteria | 15406 |
| 231 | Ga0466722_245718 | 3300042609 | Bacteria | 6417 |
| 232 | Ga0466711_088104 | 3300042615 | Bacteria | 2106 |
| 233 | Ga0466723_126889 | 3300042618 | Bacteria | 2166 |
| 234 | Ga0466729_008059 | 3300042621 | Bacteria | 10688 |
| 235 | Ga0466731_027954 | 3300042622 | Bacteria | 3939 |
| 236 | Ga0466735_074267 | 3300042624 | Bacteria | 99444 |
| 237 | Ga0466702_125540 | 3300042635 | Bacteria | 1775 |
| 238 | Ga0466703_407782 | 3300042636 | Bacteria | 5240 |
| 239 | Ga0466704_319025 | 3300042643 | Bacteria | 3680 |
| 240 | Ga0123357_10005559 | 3300009784 | Bacteria | 15127 |
| 241 | Ga0123357_10112696 | 3300009784 | Bacteria | 3460 |
| 242 | Ga0123355_10001594 | 3300009826 | Bacteria | 31632 |
| 243 | Ga0123355_10004379 | 3300009826 | Bacteria | 20539 |
| 244 | Ga0123355_10008966 | 3300009826 | Bacteria | 15156 |
| 245 | Ga0123355_10016482 | 3300009826 | Bacteria | 11646 |
| 246 | Ga0123355_10085205 | 3300009826 | Bacteria | 5030 |
| 247 | Ga0123355_10114031 | 3300009826 | Bacteria | 4214 |
| 248 | Ga0123356_10017358 | 3300010049 | Bacteria | 6847 |
| 249 | Ga0123356_10021635 | 3300010049 | Bacteria | 6069 |
| 250 | Ga0123356_10036865 | 3300010049 | Bacteria | 4564 |
| 251 | Ga0123353_10241985 | 3300010167 | Bacteria | 2803 |
| 252 | Ga0123353_10293700 | 3300010167 | Bacteria | 2486 |
| 253 | Ga0123353_10421570 | 3300010167 | Bacteria | 1977 |
| 254 | Ga0123353_10598990 | 3300010167 | Bacteria | 1576 |
| 255 | Ga0123354_10005771 | 3300010882 | Bacteria | 18135 |
| 256 | 2227303007 | 2225789004 | Bacteria | 29314 |
| 257 | IMNBL1DRAFT_c0000094 | 3300000062 | Bacteria | 77788 |
| 258 | JGI24705J35276_12217967 | 3300002504 | Bacteria | 2120 |
| 259 | Ga0072941_1019039 | 3300005201 | Bacteria | 32748 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF17956 | NAPRTase_C | Nicotinate phosphoribosyltransferase C-terminal domain | 409 | 518 | 0.98 |
| PF17767 | NAPRTase_N | Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain | 64 | 179 | 0.97 |
| PF02749 | QRPTase_N | Quinolinate phosphoribosyl transferase, N-terminal domain | 132 | 182 | 0.84 |
| PF04095 | NAPRTase | Nicotinate phosphoribosyltransferase (NAPRTase) family | 200 | 379 | 0.77 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02749 | GO:0016763 | pentosyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.