Protein Family IF05567
Metagenome
Isolate
199
Members
101
Samples
165
Scaffolds
414.98
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_025174|Ga0466706_025174_40080_41513
- Length
- 460 aa
- Sequence
- MKLILSLYIIRKYFANLLIYFKGIYILHQEERVVKSGLRNNISIRQEFFVNLLHLYSNNDWVCDMNTVEIITIGDEILIGQIVDTNSAWIAKELNKEGFKIIRITSIPDKQEDILDAFESAFKHADIVLVTGGIGPTKDDITKQTLCKYFRAEMVFNEDAYQNVLRQIADRPNAMNRLTRDQAYVPSTCIPIMNRVGTAPITWFEQDGKVLVSMPGVPEEMKWAIQHEILPRIKAHFQTPQLRHQTIIVQGNAESQLALKLEEWEDNLPAYIKLAYLPQAAFVRLRLTGQHADKEFLENTIRKKVKELKEILGKDVSKGLTFATAESCTGGNIARLMTSHPGSSHFFNGSVIAYSNEVKENVLGVNHADIERYGAVSETVVKQMVSGAGKLLNADIVVATSGIAGPEGGTEEKPVGTVWIAAGNAAKVIARKYQFGNSRKRNIEKATYAAIFLVKEFVEE
Sample Types
Isolate
17.1%
Metagenome
82.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
24.5%
Unclassified
16.0%
Kalotermitidae
13.8%
Blattidae
9.6%
Armadillidiidae
6.4%
Rhinotermitidae
4.3%
Termopsidae
4.3%
Culicidae
4.3%
Hydrophilidae
3.2%
Drosophilidae
3.2%
Passalidae
2.1%
Daphniidae
2.1%
Elmidae
2.1%
Tenebrionidae
2.1%
Hodotermitidae
1.1%
Nephropidae
1.1%
Taxonomy
Archaea
0
Bacteria
194
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 2 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 3 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 4 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 5 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 6 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 7 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 8 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 9 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 10 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 14 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 15 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 16 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 17 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 18 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 19 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 26 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 27 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 28 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 32 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 33 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 34 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 35 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 36 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 40 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 42 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 43 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 44 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 45 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 46 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 47 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 48 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 49 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 50 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 51 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 52 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 53 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 54 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 55 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 56 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 57 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 58 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 59 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 60 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 61 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 62 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 63 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 64 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 65 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 66 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 67 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 68 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 69 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 70 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 71 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 72 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 73 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 74 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 75 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 76 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 77 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 78 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 79 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 80 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 81 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 82 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 83 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 84 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 85 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 86 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 87 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 88 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 89 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 90 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 91 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 92 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 93 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 94 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 95 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 96 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 97 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 98 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 99 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 100 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 101 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160446_100004 | 3300012835 | Bacteria | 459440 |
| 2 | Ga0466712_024442 | 3300042614 | Unclassified | 2482 |
| 3 | Ga0466712_099766 | 3300042614 | Unclassified | 1715 |
| 4 | Ga0466715_567168 | 3300042616 | Bacteria | 3615 |
| 5 | Ga0466735_171261 | 3300042624 | Bacteria | 7366 |
| 6 | Ga0466703_004201 | 3300042636 | Bacteria | 12342 |
| 7 | Ga0466709_190184 | 3300042648 | Bacteria | 38440 |
| 8 | Ga0466727_148046 | 3300042655 | Bacteria | 1956 |
| 9 | Ga0123353_10019033 | 3300010167 | Bacteria | 10187 |
| 10 | Ga0466701_100931 | 3300042598 | Bacteria | 4490 |
| 11 | Ga0466706_025174 | 3300042599 | Bacteria | 118676 |
| 12 | Ga0466713_063293 | 3300042602 | Bacteria | 52242 |
| 13 | Ga0466713_083609 | 3300042602 | Bacteria | 30631 |
| 14 | 2227663506 | 2225789004 | Bacteria | 10430 |
| 15 | Ga0104048_1004042 | 3300007143 | Bacteria | 18967 |
| 16 | Ga0104050_1199698 | 3300007153 | Unclassified | 4653 |
| 17 | Ga0466697_182070 | 3300042611 | Bacteria | 8207 |
| 18 | Ga0466733_146496 | 3300042659 | Bacteria | 8541 |
| 19 | Ga0160441_100214 | 3300012825 | Bacteria | 58247 |
| 20 | Ga0160445_100225 | 3300012847 | Bacteria | 41313 |
| 21 | Ga0160445_100247 | 3300012847 | Bacteria | 38666 |
| 22 | Ga0160443_100077 | 3300012848 | Bacteria | 175780 |
| 23 | Ga0160435_1000335 | 3300012857 | Bacteria | 19209 |
| 24 | Ga0466657_053247 | 3300042582 | Bacteria | 11760 |
| 25 | Ga0466711_095847 | 3300042615 | Bacteria | 3886 |
| 26 | Ga0466711_126844 | 3300042615 | Bacteria | 12736 |
| 27 | Ga0466711_306552 | 3300042615 | Bacteria | 3587 |
| 28 | Ga0466715_030580 | 3300042616 | Bacteria | 6573 |
| 29 | Ga0466729_296814 | 3300042621 | Bacteria | 9330 |
| 30 | Ga0466727_288541 | 3300042655 | Bacteria | 3685 |
| 31 | Ga0123353_10000970 | 3300010167 | Bacteria | 35107 |
| 32 | Ga0123353_10012477 | 3300010167 | Bacteria | 12084 |
| 33 | Ga0123353_10026371 | 3300010167 | Bacteria | 8875 |
| 34 | Ga0466706_127960 | 3300042599 | Bacteria | 71121 |
| 35 | Ga0466707_276777 | 3300042601 | Bacteria | 7753 |
| 36 | Ga0466707_405313 | 3300042601 | Bacteria | 13801 |
| 37 | Ga0466714_036086 | 3300042603 | Bacteria | 3262 |
| 38 | Ga0466714_094553 | 3300042603 | Bacteria | 52205 |
| 39 | Ga0466719_302903 | 3300042606 | Bacteria | 1959 |
| 40 | Ga0104045_1002981 | 3300007085 | Bacteria | 11834 |
| 41 | Ga0466733_089518 | 3300042659 | Bacteria | 53582 |
| 42 | Ga0160432_100020 | 3300012818 | Bacteria | 281080 |
| 43 | Ga0160467_100260 | 3300012829 | Bacteria | 64032 |
| 44 | Ga0160467_103006 | 3300012829 | Bacteria | 3141 |
| 45 | Ga0160443_100149 | 3300012848 | Bacteria | 101080 |
| 46 | Ga0466694_076728 | 3300042594 | Bacteria | 24457 |
| 47 | Ga0466701_006324 | 3300042598 | Unclassified | 7709 |
| 48 | Ga0466711_058433 | 3300042615 | Bacteria | 7793 |
| 49 | Ga0466718_044003 | 3300042617 | Bacteria | 25874 |
| 50 | Ga0466731_008971 | 3300042622 | Bacteria | 33045 |
| 51 | Ga0466735_158279 | 3300042624 | Bacteria | 9325 |
| 52 | Ga0466709_130773 | 3300042648 | Bacteria | 58613 |
| 53 | Ga0466709_147679 | 3300042648 | Bacteria | 7283 |
| 54 | Ga0466724_34893 | 3300042649 | Bacteria | 121190 |
| 55 | Ga0123354_10230782 | 3300010882 | Bacteria | 1935 |
| 56 | Ga0466716_151473 | 3300042605 | Bacteria | 8091 |
| 57 | Ga0466719_105264 | 3300042606 | Bacteria | 12979 |
| 58 | Ga0466719_319393 | 3300042606 | Bacteria | 2254 |
| 59 | Ga0466722_124719 | 3300042609 | Bacteria | 18358 |
| 60 | 2227164440 | 2225789004 | Bacteria | 1544 |
| 61 | IMNBL1DRAFT_c0013246 | 3300000062 | Bacteria | 3713 |
| 62 | Ga0068305_10343316 | 3300005083 | Bacteria | 1575 |
| 63 | Ga0104048_1001901 | 3300007143 | Bacteria | 3176 |
| 64 | Ga0466705_289260 | 3300042612 | Bacteria | 9143 |
| 65 | Ga0466705_310929 | 3300042612 | Bacteria | 9190 |
| 66 | Ga0466733_157382 | 3300042659 | Bacteria | 9443 |
| 67 | Ga0466733_174420 | 3300042659 | Bacteria | 8101 |
| 68 | Ga0160468_100062 | 3300012819 | Bacteria | 150650 |
| 69 | Ga0160469_100896 | 3300012824 | Bacteria | 10141 |
| 70 | Ga0466690_159485 | 3300042590 | Bacteria | 2178 |
| 71 | Ga0466690_221425 | 3300042590 | Bacteria | 8535 |
| 72 | Ga0466715_301846 | 3300042616 | Bacteria | 6113 |
| 73 | Ga0466723_013453 | 3300042618 | Bacteria | 5349 |
| 74 | Ga0466726_049641 | 3300042619 | Bacteria | 4451 |
| 75 | Ga0466726_474730 | 3300042619 | Bacteria | 3872 |
| 76 | Ga0466728_327686 | 3300042620 | Bacteria | 44532 |
| 77 | Ga0466709_007878 | 3300042648 | Bacteria | 27583 |
| 78 | Ga0466708_431054 | 3300042652 | Bacteria | 13726 |
| 79 | Ga0466701_058922 | 3300042598 | Bacteria | 11436 |
| 80 | Ga0466701_101439 | 3300042598 | Bacteria | 2465 |
| 81 | Ga0466706_089391 | 3300042599 | Bacteria | 6268 |
| 82 | Ga0466713_025514 | 3300042602 | Bacteria | 114544 |
| 83 | IMNBL1DRAFT_c0000849 | 3300000062 | Bacteria | 23988 |
| 84 | JGI24696J40584_12956605 | 3300002834 | Bacteria | 3167 |
| 85 | Ga0072940_1052442 | 3300005200 | Bacteria | 1633 |
| 86 | Ga0104045_1020669 | 3300007085 | Bacteria | 1582 |
| 87 | Ga0160458_100163 | 3300012832 | Bacteria | 54647 |
| 88 | Ga0160433_100237 | 3300012846 | Bacteria | 40097 |
| 89 | Ga0466690_014837 | 3300042590 | Bacteria | 8618 |
| 90 | Ga0466691_023235 | 3300042593 | Bacteria | 11215 |
| 91 | Ga0466696_089643 | 3300042596 | Bacteria | 20002 |
| 92 | Ga0466696_176785 | 3300042596 | Bacteria | 19925 |
| 93 | Ga0466710_067550 | 3300042613 | Bacteria | 1596 |
| 94 | Ga0466723_024955 | 3300042618 | Bacteria | 6081 |
| 95 | Ga0466723_198328 | 3300042618 | Bacteria | 15765 |
| 96 | Ga0466726_381661 | 3300042619 | Bacteria | 3925 |
| 97 | Ga0466735_021202 | 3300042624 | Bacteria | 8101 |
| 98 | Ga0123357_10298910 | 3300009784 | Bacteria | 1630 |
| 99 | Ga0123356_10081964 | 3300010049 | Bacteria | 3053 |
| 100 | Ga0123353_10001838 | 3300010167 | Bacteria | 26117 |
| 101 | Ga0466701_102144 | 3300042598 | Bacteria | 141929 |
| 102 | Ga0466698_404598 | 3300042610 | Bacteria | 7756 |
| 103 | 2227477401 | 2225789004 | Bacteria | 22517 |
| 104 | JGI24696J40584_12961710 | 3300002834 | Bacteria | 45969 |
| 105 | Ga0466733_074709 | 3300042659 | Bacteria | 47803 |
| 106 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 107 | Ga0160453_100381 | 3300012814 | Bacteria | 37283 |
| 108 | Ga0160472_100031 | 3300012839 | Bacteria | 275018 |
| 109 | Ga0466696_100700 | 3300042596 | Bacteria | 6158 |
| 110 | Ga0466731_293300 | 3300042622 | Bacteria | 2241 |
| 111 | Ga0466703_024275 | 3300042636 | Bacteria | 27229 |
| 112 | Ga0466724_41297 | 3300042649 | Bacteria | 4417 |
| 113 | Ga0466724_46039 | 3300042649 | Bacteria | 4433 |
| 114 | Ga0123356_10004059 | 3300010049 | Bacteria | 15203 |
| 115 | Ga0123353_10000005 | 3300010167 | Bacteria | 308504 |
| 116 | Ga0123353_10040915 | 3300010167 | Bacteria | 7316 |
| 117 | Ga0123353_10376284 | 3300010167 | Bacteria | 2126 |
| 118 | Ga0123353_10394731 | 3300010167 | Bacteria | 2062 |
| 119 | Ga0123354_10078842 | 3300010882 | Bacteria | 4678 |
| 120 | Ga0123354_10186502 | 3300010882 | Unclassified | 2343 |
| 121 | Ga0123354_10228994 | 3300010882 | Bacteria | 1949 |
| 122 | Ga0160464_101684 | 3300012805 | Bacteria | 6325 |
| 123 | Ga0466707_272049 | 3300042601 | Bacteria | 5307 |
| 124 | Ga0466716_226283 | 3300042605 | Bacteria | 9940 |
| 125 | Ga0466719_149199 | 3300042606 | Bacteria | 1866 |
| 126 | Ga0466720_230677 | 3300042607 | Bacteria | 3732 |
| 127 | IMNBL1DRAFT_c0021006 | 3300000062 | Bacteria | 2625 |
| 128 | JGI24695J34938_10002688 | 3300002450 | Bacteria | 13235 |
| 129 | Ga0160430_101679 | 3300012852 | Bacteria | 7869 |
| 130 | Ga0466690_233574 | 3300042590 | Bacteria | 4210 |
| 131 | Ga0466711_264063 | 3300042615 | Bacteria | 1724 |
| 132 | Ga0466715_186486 | 3300042616 | Bacteria | 9969 |
| 133 | Ga0466723_104379 | 3300042618 | Bacteria | 2940 |
| 134 | Ga0466726_113249 | 3300042619 | Bacteria | 4996 |
| 135 | Ga0466729_186551 | 3300042621 | Bacteria | 3344 |
| 136 | Ga0466703_280154 | 3300042636 | Bacteria | 19691 |
| 137 | Ga0466709_124130 | 3300042648 | Bacteria | 272718 |
| 138 | Ga0466724_68743 | 3300042649 | Bacteria | 337166 |
| 139 | Ga0123356_10005344 | 3300010049 | Bacteria | 13093 |
| 140 | Ga0123353_10009932 | 3300010167 | Bacteria | 13205 |
| 141 | Ga0123354_10155753 | 3300010882 | Bacteria | 2742 |
| 142 | Ga0123354_10174882 | 3300010882 | Bacteria | 2480 |
| 143 | Ga0466701_042033 | 3300042598 | Bacteria | 8191 |
| 144 | Ga0466706_003908 | 3300042599 | Bacteria | 8357 |
| 145 | Ga0466706_080160 | 3300042599 | Bacteria | 27176 |
| 146 | Ga0466713_006786 | 3300042602 | Bacteria | 13628 |
| 147 | Ga0466714_030110 | 3300042603 | Bacteria | 34101 |
| 148 | IMNBL1DRAFT_c0003597 | 3300000062 | Bacteria | 9826 |
| 149 | JGI24702J35022_10001574 | 3300002462 | Bacteria | 14155 |
| 150 | Ga0104050_1203029 | 3300007153 | Bacteria | 1529 |
| 151 | Ga0466733_096786 | 3300042659 | Bacteria | 3876 |
| 152 | Ga0160433_100443 | 3300012846 | Bacteria | 21342 |
| 153 | Ga0466691_009431 | 3300042593 | Bacteria | 6007 |
| 154 | Ga0466701_007914 | 3300042598 | Bacteria | 29857 |
| 155 | Ga0466701_015235 | 3300042598 | Bacteria | 2633 |
| 156 | Ga0466710_287011 | 3300042613 | Bacteria | 2315 |
| 157 | Ga0466730_073669 | 3300042625 | Bacteria | 406091 |
| 158 | Ga0466708_036877 | 3300042652 | Bacteria | 3527 |
| 159 | Ga0123353_10000041 | 3300010167 | Bacteria | 137212 |
| 160 | Ga0466713_034599 | 3300042602 | Bacteria | 147320 |
| 161 | Ga0466714_015825 | 3300042603 | Bacteria | 102725 |
| 162 | Ga0466719_559050 | 3300042606 | Bacteria | 1817 |
| 163 | JGI24698J34947_10073961 | 3300002449 | Bacteria | 1624 |
| 164 | JGI24696J40584_12958679 | 3300002834 | Bacteria | 4322 |
| 165 | Ga0068302_10003974 | 3300005071 | Bacteria | 4140 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.