Protein Family IF05556
Metagenome
Isolate
180
Members
56
Samples
169
Scaffolds
141.66
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_010437|Ga0466706_010437_6333_6824
- Length
- 163 aa
- Sequence
- MNILIAAKPGGYPTYEEKNKMRNPQLMIAKLIDKQRVAFIASVDANGIPNMKAMLPPRRREGIRVFYFSTNTSSERVAQYRANPKASIYFYSKCLWSYRGVMLKGTMDVLEDAESKQMLWKRGDTIYYPGGVTDPDYCVLRFTATAGRYYANFKSESFYVEGT
Sample Types
Isolate
6.1%
Metagenome
93.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.6%
Unclassified
23.6%
Kalotermitidae
21.8%
Termopsidae
5.5%
Rhinotermitidae
3.6%
Hodotermitidae
1.8%
Taxonomy
Archaea
10
Bacteria
139
Eukaryota
0
Viruses
0
Unclassified
31
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 2 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 3 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 4 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 5 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 6 | 2820039837 | Unclassified Saccharibacteria Emb289P1bin99 | Isolate | Unclassified |
| 7 | 2820439761 | Unclassified Firmicutes Lab288P3bin203 | Isolate | Unclassified |
| 8 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 9 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 10 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 11 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 12 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 13 | 2820906387 | Unclassified Actinobacteria Emb289P4bin41 | Isolate | Unclassified |
| 14 | 2820263778 | Unclassified Firmicutes Th196P3bin37 | Isolate | Unclassified |
| 15 | 2772190994 | Unclassified Bathyarchaeota Lab288P3bin169 | Isolate | Unclassified |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 18 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 19 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 20 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 21 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 22 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 25 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 33 | 2772190996 | Unclassified Bathyarchaeota Lab288P4bin61 | Isolate | Unclassified |
| 34 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 40 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 41 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 42 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 43 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 44 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 49 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 50 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 51 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 52 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 53 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 54 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 55 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 56 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_177108 | 3300042612 | Unclassified | 3547 |
| 2 | Ga0466733_023595 | 3300042659 | Bacteria | 1058 |
| 3 | Ga0466701_035505 | 3300042598 | Archaea | 4384 |
| 4 | Ga0466706_010437 | 3300042599 | Bacteria | 6834 |
| 5 | Ga0466706_093716 | 3300042599 | Bacteria | 1422 |
| 6 | Ga0466714_072797 | 3300042603 | Unclassified | 1794 |
| 7 | Ga0466714_117605 | 3300042603 | Bacteria | 1864 |
| 8 | Ga0123355_10940761 | 3300009826 | Bacteria | 930 |
| 9 | Ga0123356_10006469 | 3300010049 | Bacteria | 11807 |
| 10 | Ga0123356_10678635 | 3300010049 | Bacteria | 1198 |
| 11 | Ga0123353_10138265 | 3300010167 | Bacteria | 3905 |
| 12 | Ga0123353_10257187 | 3300010167 | Bacteria | 2700 |
| 13 | Ga0466715_411140 | 3300042616 | Unclassified | 1606 |
| 14 | Ga0466729_107099 | 3300042621 | Bacteria | 7998 |
| 15 | JGI24695J34938_10013984 | 3300002450 | Bacteria | 4187 |
| 16 | JGI24705J35276_12086044 | 3300002504 | Unclassified | 984 |
| 17 | Ga0068305_10252597 | 3300005083 | Unclassified | 1099 |
| 18 | Ga0466704_477085 | 3300042643 | Unclassified | 1719 |
| 19 | Ga0466708_088578 | 3300042652 | Bacteria | 2157 |
| 20 | Ga0466708_282884 | 3300042652 | Bacteria | 1022 |
| 21 | Ga0466733_030570 | 3300042659 | Bacteria | 1742 |
| 22 | Ga0466733_035991 | 3300042659 | Bacteria | 45902 |
| 23 | Ga0466656_102002 | 3300042550 | Unclassified | 1210 |
| 24 | Ga0466694_005718 | 3300042594 | Archaea | 3198 |
| 25 | Ga0466694_263512 | 3300042594 | Bacteria | 32799 |
| 26 | Ga0466706_023971 | 3300042599 | Bacteria | 10782 |
| 27 | Ga0466706_065137 | 3300042599 | Bacteria | 2073 |
| 28 | Ga0466706_145192 | 3300042599 | Bacteria | 5428 |
| 29 | Ga0466700_244252 | 3300042600 | Bacteria | 2600 |
| 30 | Ga0466716_171815 | 3300042605 | Bacteria | 1775 |
| 31 | Ga0466719_182913 | 3300042606 | Unclassified | 1011 |
| 32 | Ga0466722_236906 | 3300042609 | Bacteria | 48943 |
| 33 | Ga0123357_10925589 | 3300009784 | Unclassified | 558 |
| 34 | Ga0123356_10013785 | 3300010049 | Bacteria | 7785 |
| 35 | Ga0123356_12153542 | 3300010049 | Bacteria | 697 |
| 36 | Ga0123353_10157533 | 3300010167 | Bacteria | 3618 |
| 37 | Ga0123353_10544716 | 3300010167 | Bacteria | 1676 |
| 38 | Ga0123353_12376600 | 3300010167 | Unclassified | 635 |
| 39 | Ga0123353_12861188 | 3300010167 | Unclassified | 563 |
| 40 | Ga0466715_005415 | 3300042616 | Bacteria | 13209 |
| 41 | Ga0466726_488761 | 3300042619 | Bacteria | 1547 |
| 42 | Ga0466728_115287 | 3300042620 | Bacteria | 3398 |
| 43 | JGI24695J34938_10118406 | 3300002450 | Bacteria | 1078 |
| 44 | JGI24705J35276_12225406 | 3300002504 | Bacteria | 2717 |
| 45 | Ga0068302_10072037 | 3300005071 | Bacteria | 1236 |
| 46 | Ga0123357_10003703 | 3300009784 | Bacteria | 17649 |
| 47 | Ga0466704_140732 | 3300042643 | Archaea | 3203 |
| 48 | Ga0466704_208094 | 3300042643 | Bacteria | 2135 |
| 49 | Ga0466704_441000 | 3300042643 | Bacteria | 2571 |
| 50 | Ga0466705_195169 | 3300042612 | Bacteria | 4435 |
| 51 | Ga0466657_167396 | 3300042582 | Bacteria | 1298 |
| 52 | Ga0466696_309281 | 3300042596 | Bacteria | 1982 |
| 53 | Ga0466706_214154 | 3300042599 | Bacteria | 15435 |
| 54 | Ga0466707_260279 | 3300042601 | Bacteria | 1427 |
| 55 | Ga0466713_098837 | 3300042602 | Bacteria | 1055 |
| 56 | Ga0466717_162745 | 3300042604 | Unclassified | 5584 |
| 57 | Ga0466716_079666 | 3300042605 | Bacteria | 1015 |
| 58 | Ga0123357_10200526 | 3300009784 | Bacteria | 2272 |
| 59 | Ga0123353_10146456 | 3300010167 | Unclassified | 3775 |
| 60 | Ga0123353_11525920 | 3300010167 | Bacteria | 849 |
| 61 | Ga0123354_10190941 | 3300010882 | Bacteria | 2293 |
| 62 | Ga0466705_416532 | 3300042612 | Unclassified | 1360 |
| 63 | Ga0466705_417195 | 3300042612 | Bacteria | 2316 |
| 64 | Ga0466710_133002 | 3300042613 | Bacteria | 19709 |
| 65 | Ga0466726_130754 | 3300042619 | Bacteria | 2087 |
| 66 | Ga0466728_118473 | 3300042620 | Bacteria | 8600 |
| 67 | Ga0466657_132826 | 3300042582 | Bacteria | 9786 |
| 68 | Ga0466696_487968 | 3300042596 | Bacteria | 2032 |
| 69 | Ga0466701_052839 | 3300042598 | Bacteria | 1812 |
| 70 | Ga0466717_228092 | 3300042604 | Bacteria | 1028 |
| 71 | Ga0466716_005871 | 3300042605 | Bacteria | 1151 |
| 72 | Ga0466719_483595 | 3300042606 | Unclassified | 1149 |
| 73 | Ga0123355_10573813 | 3300009826 | Unclassified | 1352 |
| 74 | Ga0123356_10000633 | 3300010049 | Bacteria | 38833 |
| 75 | Ga0123356_10001836 | 3300010049 | Bacteria | 23044 |
| 76 | Ga0123356_11065155 | 3300010049 | Bacteria | 978 |
| 77 | Ga0123353_10429141 | 3300010167 | Unclassified | 1955 |
| 78 | Ga0123353_12062182 | 3300010167 | Bacteria | 696 |
| 79 | Ga0123354_10397192 | 3300010882 | Bacteria | 1171 |
| 80 | Ga0466718_065044 | 3300042617 | Bacteria | 1216 |
| 81 | Ga0466718_126269 | 3300042617 | Unclassified | 1872 |
| 82 | Ga0466726_359374 | 3300042619 | Unclassified | 6289 |
| 83 | JGI24695J34938_10057690 | 3300002450 | Bacteria | 1667 |
| 84 | JGI24705J35276_12192500 | 3300002504 | Unclassified | 1488 |
| 85 | Ga0466734_088294 | 3300042623 | Bacteria | 9275 |
| 86 | Ga0466704_325542 | 3300042643 | Bacteria | 32314 |
| 87 | Ga0466704_486933 | 3300042643 | Bacteria | 2688 |
| 88 | Ga0466709_294995 | 3300042648 | Bacteria | 3182 |
| 89 | Ga0466708_043022 | 3300042652 | Unclassified | 1724 |
| 90 | Ga0466708_147890 | 3300042652 | Bacteria | 1312 |
| 91 | Ga0466708_435834 | 3300042652 | Bacteria | 1111 |
| 92 | Ga0466725_074974 | 3300042654 | Bacteria | 1025 |
| 93 | Ga0466705_075101 | 3300042612 | Bacteria | 2361 |
| 94 | Ga0466705_379295 | 3300042612 | Bacteria | 44201 |
| 95 | Ga0466733_098355 | 3300042659 | Unclassified | 1029 |
| 96 | Ga0466733_112228 | 3300042659 | Bacteria | 20454 |
| 97 | Ga0466691_034226 | 3300042593 | Bacteria | 4646 |
| 98 | Ga0466694_154748 | 3300042594 | Bacteria | 1857 |
| 99 | Ga0466694_280577 | 3300042594 | Bacteria | 1628 |
| 100 | Ga0466696_094463 | 3300042596 | Bacteria | 5923 |
| 101 | Ga0466706_062980 | 3300042599 | Bacteria | 9746 |
| 102 | Ga0466706_148644 | 3300042599 | Bacteria | 15152 |
| 103 | Ga0466706_158986 | 3300042599 | Bacteria | 1944 |
| 104 | Ga0466707_225925 | 3300042601 | Bacteria | 2161 |
| 105 | Ga0466717_037830 | 3300042604 | Unclassified | 1099 |
| 106 | Ga0466722_257044 | 3300042609 | Bacteria | 3260 |
| 107 | Ga0123357_10097583 | 3300009784 | Bacteria | 3801 |
| 108 | Ga0123353_10941303 | 3300010167 | Bacteria | 1170 |
| 109 | Ga0123353_11261613 | 3300010167 | Archaea | 963 |
| 110 | Ga0466715_382697 | 3300042616 | Bacteria | 2886 |
| 111 | Ga0466726_029322 | 3300042619 | Bacteria | 3649 |
| 112 | Ga0466729_032014 | 3300042621 | Bacteria | 1530 |
| 113 | Ga0072940_1079691 | 3300005200 | Bacteria | 8350 |
| 114 | Ga0466734_123345 | 3300042623 | Bacteria | 5860 |
| 115 | Ga0466704_003415 | 3300042643 | Bacteria | 39135 |
| 116 | Ga0466709_078243 | 3300042648 | Bacteria | 1899 |
| 117 | Ga0466708_131559 | 3300042652 | Bacteria | 9241 |
| 118 | Ga0466733_038601 | 3300042659 | Bacteria | 3875 |
| 119 | Ga0466694_000246 | 3300042594 | Bacteria | 6468 |
| 120 | Ga0466695_132341 | 3300042595 | Bacteria | 2702 |
| 121 | Ga0466696_029581 | 3300042596 | Bacteria | 14800 |
| 122 | Ga0466706_004306 | 3300042599 | Bacteria | 7031 |
| 123 | Ga0466706_118432 | 3300042599 | Bacteria | 5175 |
| 124 | Ga0466717_086069 | 3300042604 | Unclassified | 3250 |
| 125 | Ga0466719_332003 | 3300042606 | Bacteria | 1082 |
| 126 | Ga0123355_10000124 | 3300009826 | Bacteria | 88857 |
| 127 | Ga0123355_10068455 | 3300009826 | Bacteria | 5710 |
| 128 | Ga0123356_11030549 | 3300010049 | Unclassified | 993 |
| 129 | Ga0123353_10668112 | 3300010167 | Bacteria | 1466 |
| 130 | Ga0123353_10674752 | 3300010167 | Bacteria | 1457 |
| 131 | Ga0123353_11504262 | 3300010167 | Bacteria | 857 |
| 132 | Ga0123353_11781282 | 3300010167 | Bacteria | 766 |
| 133 | Ga0123353_12375578 | 3300010167 | Unclassified | 635 |
| 134 | Ga0123353_12650288 | 3300010167 | Bacteria | 592 |
| 135 | Ga0123354_10807169 | 3300010882 | Bacteria | 631 |
| 136 | Ga0466715_408354 | 3300042616 | Bacteria | 1206 |
| 137 | Ga0466715_451318 | 3300042616 | Bacteria | 5986 |
| 138 | Ga0466718_083590 | 3300042617 | Bacteria | 1810 |
| 139 | Ga0068305_10375323 | 3300005083 | Bacteria | 1232 |
| 140 | Ga0072941_1057757 | 3300005201 | Bacteria | 1269 |
| 141 | Ga0072941_1215086 | 3300005201 | Archaea | 1004 |
| 142 | Ga0466729_253854 | 3300042621 | Bacteria | 2065 |
| 143 | Ga0466727_198971 | 3300042655 | Bacteria | 11559 |
| 144 | Ga0466705_134398 | 3300042612 | Bacteria | 8281 |
| 145 | Ga0466693_431406 | 3300042592 | Bacteria | 1064 |
| 146 | Ga0466696_049508 | 3300042596 | Bacteria | 5979 |
| 147 | Ga0466706_251733 | 3300042599 | Bacteria | 1809 |
| 148 | Ga0466697_013615 | 3300042611 | Bacteria | 5053 |
| 149 | Ga0123356_10045833 | 3300010049 | Bacteria | 4068 |
| 150 | Ga0123353_10380075 | 3300010167 | Bacteria | 2113 |
| 151 | Ga0123353_11437580 | 3300010167 | Unclassified | 883 |
| 152 | Ga0466715_203825 | 3300042616 | Bacteria | 1236 |
| 153 | Ga0466726_212307 | 3300042619 | Archaea | 1214 |
| 154 | Ga0466729_061309 | 3300042621 | Bacteria | 5469 |
| 155 | Ga0466731_339556 | 3300042622 | Unclassified | 1521 |
| 156 | Ga0466703_368452 | 3300042636 | Bacteria | 6651 |
| 157 | Ga0466709_368974 | 3300042648 | Bacteria | 39827 |
| 158 | Ga0466705_352879 | 3300042612 | Bacteria | 2848 |
| 159 | Ga0466694_138580 | 3300042594 | Bacteria | 35919 |
| 160 | Ga0466706_103296 | 3300042599 | Bacteria | 1074 |
| 161 | Ga0466713_070578 | 3300042602 | Unclassified | 2151 |
| 162 | Ga0123355_10300601 | 3300009826 | Archaea | 2188 |
| 163 | Ga0123356_11078565 | 3300010049 | Bacteria | 972 |
| 164 | Ga0123353_11661667 | 3300010167 | Archaea | 802 |
| 165 | Ga0123354_10002692 | 3300010882 | Unclassified | 23800 |
| 166 | Ga0123354_10378336 | 3300010882 | Bacteria | 1226 |
| 167 | Ga0466715_530894 | 3300042616 | Bacteria | 1607 |
| 168 | JGI24705J35276_12224633 | 3300002504 | Bacteria | 2631 |
| 169 | Ga0466703_312925 | 3300042636 | Unclassified | 1134 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.