Protein Family IF05463
Metagenome
Metatranscriptome
Isolate
167
Members
40
Samples
158
Scaffolds
117.22
Avg Length
Representative Sequence
- ID
- 3300042598|Ga0466701_035995|Ga0466701_035995_24408_24761
- Length
- 117 aa
- Sequence
- MTVVSENDQEYRFGDSGPKYLLRGPRMNFGIVVLKPGQDFPAHYHNIMEENFFILEGELEIHIDYEIFHCKKGDFVHVEPKRVHYLVNKGNTDFKAAFMLAPFQEKDKVDVDYKPTV
Sample Types
Isolate
5.4%
Metagenome
93.4%
MAG
0.0%
Metatranscriptome
1.2%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
59.5%
Unclassified
24.3%
Kalotermitidae
10.8%
Hodotermitidae
2.7%
Termopsidae
2.7%
Taxonomy
Archaea
0
Bacteria
132
Eukaryota
0
Viruses
0
Unclassified
35
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 2 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 3 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 4 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 5 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 6 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 14 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 15 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 16 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 19 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 20 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 21 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 22 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 25 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 29 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 30 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 31 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 32 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 33 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 34 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 35 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 36 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 37 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 40 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_114213 | 3300042612 | Unclassified | 2585 |
| 2 | Ga0466712_033229 | 3300042614 | Unclassified | 2564 |
| 3 | Ga0466712_127270 | 3300042614 | Bacteria | 17968 |
| 4 | Ga0466718_102936 | 3300042617 | Bacteria | 3220 |
| 5 | Ga0466718_153973 | 3300042617 | Bacteria | 3300 |
| 6 | Ga0466728_062291 | 3300042620 | Bacteria | 4796 |
| 7 | Ga0466720_048255 | 3300042607 | Bacteria | 5476 |
| 8 | Ga0264413_101847 | 3300024493 | Bacteria | 86591 |
| 9 | Ga0123356_11582446 | 3300010049 | Unclassified | 811 |
| 10 | Ga0123353_10391661 | 3300010167 | Bacteria | 2072 |
| 11 | Nasutiter_Contig47930 | 2030936001 | Unclassified | 947 |
| 12 | JGI24698J34947_10002909 | 3300002449 | Bacteria | 9286 |
| 13 | JGI24698J34947_10008382 | 3300002449 | Bacteria | 5673 |
| 14 | JGI24698J34947_10043382 | 3300002449 | Bacteria | 2306 |
| 15 | JGI24698J34947_10056025 | 3300002449 | Bacteria | 1962 |
| 16 | JGI24698J34947_10104755 | 3300002449 | Unclassified | 1263 |
| 17 | JGI24698J34947_10124923 | 3300002449 | Unclassified | 1110 |
| 18 | JGI24695J34938_10000178 | 3300002450 | Bacteria | 59181 |
| 19 | JGI24695J34938_10000406 | 3300002450 | Bacteria | 41980 |
| 20 | JGI24695J34938_10001170 | 3300002450 | Bacteria | 23318 |
| 21 | JGI24695J34938_10018804 | 3300002450 | Unclassified | 3440 |
| 22 | JGI24695J34938_10185015 | 3300002450 | Bacteria | 863 |
| 23 | Ga0072941_1029196 | 3300005201 | Bacteria | 4033 |
| 24 | Ga0072941_1052180 | 3300005201 | Bacteria | 2651 |
| 25 | Ga0466733_082577 | 3300042659 | Bacteria | 7749 |
| 26 | Ga0466712_024272 | 3300042614 | Unclassified | 1544 |
| 27 | Ga0466712_041916 | 3300042614 | Bacteria | 16385 |
| 28 | Ga0466712_186178 | 3300042614 | Unclassified | 1051 |
| 29 | Ga0466718_003699 | 3300042617 | Bacteria | 2895 |
| 30 | Ga0466701_057554 | 3300042598 | Bacteria | 1076 |
| 31 | Ga0466720_068309 | 3300042607 | Unclassified | 2021 |
| 32 | Ga0264413_123962 | 3300024493 | Bacteria | 3485 |
| 33 | Ga0415639_176966 | 3300038395 | Bacteria | 2854 |
| 34 | Ga0466699_302539 | 3300042597 | Bacteria | 1453 |
| 35 | AustNasuHG_c1009911 | 3300000089 | Unclassified | 3332 |
| 36 | AustNasuHG_c1010281 | 3300000089 | Bacteria | 3264 |
| 37 | AustNasuHG_c1036321 | 3300000089 | Bacteria | 1280 |
| 38 | JGI24698J34947_10061280 | 3300002449 | Bacteria | 1852 |
| 39 | JGI24698J34947_10183713 | 3300002449 | Bacteria | 833 |
| 40 | JGI24698J34947_10296224 | 3300002449 | Bacteria | 585 |
| 41 | JGI24695J34938_10001101 | 3300002450 | Bacteria | 24350 |
| 42 | JGI24695J34938_10053715 | 3300002450 | Unclassified | 1751 |
| 43 | JGI24695J34938_10136813 | 3300002450 | Bacteria | 1000 |
| 44 | JGI24695J34938_10593998 | 3300002450 | Bacteria | 515 |
| 45 | JGI24699J35502_11127581 | 3300002509 | Bacteria | 4186 |
| 46 | Ga0072941_1022120 | 3300005201 | Bacteria | 30539 |
| 47 | Ga0074263_129880 | 3300005485 | Bacteria | 838 |
| 48 | Ga0466712_055306 | 3300042614 | Unclassified | 1337 |
| 49 | Ga0466712_095475 | 3300042614 | Bacteria | 34280 |
| 50 | Ga0466712_213622 | 3300042614 | Unclassified | 1090 |
| 51 | Ga0466712_226564 | 3300042614 | Bacteria | 10213 |
| 52 | Ga0466720_112090 | 3300042607 | Bacteria | 27214 |
| 53 | Ga0466720_205791 | 3300042607 | Bacteria | 4393 |
| 54 | Ga0466703_188879 | 3300042636 | Bacteria | 76658 |
| 55 | Ga0255786_1006672 | 3300022815 | Unclassified | 1083 |
| 56 | Ga0264413_133794 | 3300024493 | Unclassified | 3962 |
| 57 | Ga0466699_128148 | 3300042597 | Bacteria | 1071 |
| 58 | Ga0466699_348518 | 3300042597 | Bacteria | 1955 |
| 59 | Ga0123356_10033053 | 3300010049 | Bacteria | 4838 |
| 60 | Ga0123356_11190381 | 3300010049 | Unclassified | 928 |
| 61 | Ga0123356_12517476 | 3300010049 | Bacteria | 644 |
| 62 | AustNasuHG_c1000049 | 3300000089 | Bacteria | 30482 |
| 63 | AustNasuHG_c1004839 | 3300000089 | Unclassified | 4821 |
| 64 | AustNasuHG_c1007910 | 3300000089 | Bacteria | 3769 |
| 65 | AustNasuHG_c1021570 | 3300000089 | Unclassified | 2082 |
| 66 | JGI24698J34947_10012471 | 3300002449 | Bacteria | 4659 |
| 67 | JGI24698J34947_10040474 | 3300002449 | Bacteria | 2406 |
| 68 | JGI24698J34947_10082405 | 3300002449 | Bacteria | 1504 |
| 69 | JGI24698J34947_10106016 | 3300002449 | Unclassified | 1251 |
| 70 | JGI24698J34947_10268093 | 3300002449 | Unclassified | 630 |
| 71 | JGI24695J34938_10002142 | 3300002450 | Bacteria | 15418 |
| 72 | JGI24695J34938_10066011 | 3300002450 | Bacteria | 1526 |
| 73 | JGI24695J34938_10126683 | 3300002450 | Bacteria | 1040 |
| 74 | Ga0466712_285549 | 3300042614 | Unclassified | 2693 |
| 75 | Ga0466726_272845 | 3300042619 | Bacteria | 5631 |
| 76 | Ga0255786_1014462 | 3300022815 | Bacteria | 655 |
| 77 | Ga0264413_117744 | 3300024493 | Bacteria | 4618 |
| 78 | Ga0264413_120515 | 3300024493 | Bacteria | 3301 |
| 79 | AustNasuHG_c1022977 | 3300000089 | Unclassified | 1997 |
| 80 | JGI24698J34947_10016711 | 3300002449 | Bacteria | 3981 |
| 81 | JGI24698J34947_10154308 | 3300002449 | Bacteria | 949 |
| 82 | JGI24695J34938_10053555 | 3300002450 | Bacteria | 1754 |
| 83 | JGI24703J35330_11259453 | 3300002501 | Bacteria | 811 |
| 84 | Ga0072941_1027165 | 3300005201 | Bacteria | 1218 |
| 85 | Ga0074263_105955 | 3300005485 | Bacteria | 2873 |
| 86 | Ga0466712_215923 | 3300042614 | Unclassified | 4435 |
| 87 | Ga0466712_286142 | 3300042614 | Bacteria | 4199 |
| 88 | Ga0466718_009338 | 3300042617 | Bacteria | 15959 |
| 89 | Ga0466718_070781 | 3300042617 | Bacteria | 1769 |
| 90 | Ga0466701_035995 | 3300042598 | Bacteria | 47930 |
| 91 | Ga0466720_168952 | 3300042607 | Bacteria | 58654 |
| 92 | Ga0466720_181745 | 3300042607 | Bacteria | 1123 |
| 93 | Ga0466720_191800 | 3300042607 | Unclassified | 22395 |
| 94 | Ga0466702_350760 | 3300042635 | Bacteria | 11855 |
| 95 | Ga0123356_10082137 | 3300010049 | Bacteria | 3050 |
| 96 | Ga0123356_10424413 | 3300010049 | Bacteria | 1473 |
| 97 | Ga0123356_10779106 | 3300010049 | Bacteria | 1127 |
| 98 | Ga0123356_10969379 | 3300010049 | Bacteria | 1021 |
| 99 | FAAS_10006733 | 3300001880 | Unclassified | 811 |
| 100 | JGI24698J34947_10032154 | 3300002449 | Unclassified | 2756 |
| 101 | JGI24695J34938_10002138 | 3300002450 | Bacteria | 15433 |
| 102 | JGI24695J34938_10002601 | 3300002450 | Bacteria | 13589 |
| 103 | JGI24695J34938_10031814 | 3300002450 | Bacteria | 2444 |
| 104 | JGI24695J34938_10120995 | 3300002450 | Unclassified | 1066 |
| 105 | JGI24699J35502_10960520 | 3300002509 | Unclassified | 1202 |
| 106 | Ga0072940_1039360 | 3300005200 | Bacteria | 2412 |
| 107 | Ga0072941_1129880 | 3300005201 | Bacteria | 2142 |
| 108 | Ga0466712_043266 | 3300042614 | Bacteria | 2300 |
| 109 | Ga0466712_092776 | 3300042614 | Unclassified | 1149 |
| 110 | Ga0466720_056009 | 3300042607 | Bacteria | 7931 |
| 111 | Ga0466731_111663 | 3300042622 | Unclassified | 1168 |
| 112 | Ga0466702_344552 | 3300042635 | Bacteria | 3185 |
| 113 | Ga0466704_368110 | 3300042643 | Bacteria | 1401 |
| 114 | Ga0264413_103040 | 3300024493 | Bacteria | 44618 |
| 115 | Ga0466694_191302 | 3300042594 | Bacteria | 4479 |
| 116 | Ga0466699_003960 | 3300042597 | Bacteria | 2220 |
| 117 | Ga0466699_310522 | 3300042597 | Bacteria | 1650 |
| 118 | Ga0466699_345107 | 3300042597 | Bacteria | 1880 |
| 119 | Ga0123356_10035441 | 3300010049 | Bacteria | 4662 |
| 120 | JGI24698J34947_10020493 | 3300002449 | Bacteria | 3560 |
| 121 | JGI24698J34947_10132526 | 3300002449 | Unclassified | 1062 |
| 122 | JGI24695J34938_10001286 | 3300002450 | Bacteria | 22002 |
| 123 | JGI24695J34938_10002296 | 3300002450 | Bacteria | 14738 |
| 124 | JGI24695J34938_10015410 | 3300002450 | Bacteria | 3924 |
| 125 | Ga0072941_1088820 | 3300005201 | Bacteria | 1550 |
| 126 | Ga0466712_116503 | 3300042614 | Bacteria | 2567 |
| 127 | Ga0466712_249225 | 3300042614 | Unclassified | 1068 |
| 128 | Ga0466712_268320 | 3300042614 | Bacteria | 16912 |
| 129 | Ga0466718_027202 | 3300042617 | Bacteria | 16899 |
| 130 | Ga0466706_033518 | 3300042599 | Bacteria | 1933 |
| 131 | Ga0466731_005122 | 3300042622 | Bacteria | 2175 |
| 132 | Ga0264413_105187 | 3300024493 | Bacteria | 14700 |
| 133 | Ga0466693_331378 | 3300042592 | Bacteria | 1903 |
| 134 | Ga0466694_029996 | 3300042594 | Bacteria | 2513 |
| 135 | Ga0466699_017315 | 3300042597 | Bacteria | 3170 |
| 136 | Ga0123356_10282638 | 3300010049 | Bacteria | 1755 |
| 137 | Ga0123353_10002487 | 3300010167 | Bacteria | 22942 |
| 138 | JGI24698J34947_10079478 | 3300002449 | Bacteria | 1544 |
| 139 | JGI24695J34938_10002288 | 3300002450 | Bacteria | 14774 |
| 140 | JGI24695J34938_10058761 | 3300002450 | Bacteria | 1648 |
| 141 | JGI24695J34938_10167263 | 3300002450 | Bacteria | 906 |
| 142 | JGI24695J34938_10242161 | 3300002450 | Unclassified | 763 |
| 143 | Ga0072941_1006518 | 3300005201 | Bacteria | 8863 |
| 144 | Ga0466712_091980 | 3300042614 | Bacteria | 13610 |
| 145 | Ga0466726_274314 | 3300042619 | Bacteria | 1354 |
| 146 | Ga0466702_168202 | 3300042635 | Bacteria | 1084 |
| 147 | Ga0466704_035683 | 3300042643 | Bacteria | 4590 |
| 148 | Ga0466699_010586 | 3300042597 | Bacteria | 2058 |
| 149 | Ga0466699_244166 | 3300042597 | Bacteria | 3527 |
| 150 | Ga0123356_10117075 | 3300010049 | Bacteria | 2585 |
| 151 | Ga0123356_12425043 | 3300010049 | Bacteria | 656 |
| 152 | AustNasuHG_c1047493 | 3300000089 | Unclassified | 956 |
| 153 | JGI24698J34947_10004069 | 3300002449 | Bacteria | 7942 |
| 154 | JGI24698J34947_10061767 | 3300002449 | Bacteria | 1842 |
| 155 | JGI24695J34938_10086481 | 3300002450 | Bacteria | 1290 |
| 156 | Ga0072940_1001052 | 3300005200 | Bacteria | 7774 |
| 157 | Ga0072941_1065342 | 3300005201 | Bacteria | 3547 |
| 158 | Ga0074263_141261 | 3300005485 | Bacteria | 853 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF16867 | GO:0047869 | dimethylpropiothetin dethiomethylase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.