Protein Family IF05381
Metagenome
Metatranscriptome
Isolate
161
Members
60
Samples
143
Scaffolds
180.01
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_441810|Ga0466699_441810_397_951
- Length
- 170 aa
- Sequence
- MQTVIDSSEEKMKKTVASLKDGFRASAALFDKIRVDYYGEKSPLNQVANISVPEARLIVIQPWDKSLIGEIEKAIRSSELSLNPSNDGKVIRIAVPPLTEERRKDLVKLAKNQAEQSRVAIRNIRRDGNDELKKLLKDASITEDDESKTNSYIDKVNLVLEEKEKEIMEV
Sample Types
Isolate
11.2%
Metagenome
88.2%
MAG
0.0%
Metatranscriptome
0.6%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.9%
Unclassified
31.0%
Kalotermitidae
19.0%
Rhinotermitidae
5.2%
Termopsidae
5.2%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
154
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 13 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 20 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 23 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 24 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 25 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 26 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 27 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 28 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 29 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 30 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 37 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 38 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 39 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 40 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 41 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 46 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 47 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 48 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 49 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 50 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 51 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 52 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 53 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 54 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 55 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 56 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 57 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 58 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 59 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 60 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10029454 | 3300010049 | Bacteria | 5142 |
| 2 | Ga0123356_10953429 | 3300010049 | Bacteria | 1029 |
| 3 | Ga0466692_083116 | 3300042591 | Bacteria | 14633 |
| 4 | Ga0466691_188502 | 3300042593 | Bacteria | 7508 |
| 5 | Ga0466699_374239 | 3300042597 | Unclassified | 1740 |
| 6 | Ga0466699_435149 | 3300042597 | Bacteria | 1076 |
| 7 | Ga0466699_441810 | 3300042597 | Bacteria | 1030 |
| 8 | Ga0466711_037161 | 3300042615 | Bacteria | 9971 |
| 9 | Ga0466715_562184 | 3300042616 | Bacteria | 3546 |
| 10 | Ga0466726_490744 | 3300042619 | Bacteria | 1168 |
| 11 | JGI24698J34947_10000681 | 3300002449 | Bacteria | 16593 |
| 12 | JGI24698J34947_10054752 | 3300002449 | Unclassified | 1990 |
| 13 | JGI24695J34938_10000830 | 3300002450 | Bacteria | 28741 |
| 14 | JGI24695J34938_10012957 | 3300002450 | Bacteria | 4396 |
| 15 | JGI24695J34938_10013768 | 3300002450 | Bacteria | 4232 |
| 16 | JGI24695J34938_10027549 | 3300002450 | Bacteria | 2685 |
| 17 | Ga0466729_234458 | 3300042621 | Bacteria | 1213 |
| 18 | Ga0466727_334729 | 3300042655 | Bacteria | 1081 |
| 19 | Ga0466722_256830 | 3300042609 | Bacteria | 37060 |
| 20 | Ga0466732_362013 | 3300042656 | Bacteria | 4987 |
| 21 | Ga0123356_10018720 | 3300010049 | Bacteria | 6573 |
| 22 | Ga0123356_10082476 | 3300010049 | Bacteria | 3044 |
| 23 | Ga0466693_365247 | 3300042592 | Bacteria | 2179 |
| 24 | Ga0466694_110602 | 3300042594 | Bacteria | 2868 |
| 25 | Ga0466699_161486 | 3300042597 | Bacteria | 1460 |
| 26 | Ga0466699_185985 | 3300042597 | Bacteria | 14320 |
| 27 | Ga0466712_052201 | 3300042614 | Bacteria | 1746 |
| 28 | Ga0466712_053392 | 3300042614 | Bacteria | 4526 |
| 29 | Ga0466712_066353 | 3300042614 | Bacteria | 17178 |
| 30 | Ga0466712_245594 | 3300042614 | Bacteria | 24408 |
| 31 | Ga0466711_478015 | 3300042615 | Bacteria | 3919 |
| 32 | Ga0466723_049536 | 3300042618 | Bacteria | 40266 |
| 33 | JGI24698J34947_10000094 | 3300002449 | Bacteria | 30023 |
| 34 | JGI24698J34947_10008877 | 3300002449 | Bacteria | 5517 |
| 35 | JGI24698J34947_10087087 | 3300002449 | Bacteria | 1445 |
| 36 | JGI24695J34938_10000203 | 3300002450 | Bacteria | 56250 |
| 37 | JGI24695J34938_10000229 | 3300002450 | Bacteria | 53063 |
| 38 | JGI24695J34938_10002852 | 3300002450 | Bacteria | 12593 |
| 39 | JGI24695J34938_10011879 | 3300002450 | Bacteria | 4655 |
| 40 | Ga0072941_1009282 | 3300005201 | Bacteria | 26178 |
| 41 | Ga0466705_203115 | 3300042612 | Bacteria | 8798 |
| 42 | Ga0466705_381407 | 3300042612 | Bacteria | 18649 |
| 43 | Ga0466702_330760 | 3300042635 | Bacteria | 1236 |
| 44 | Ga0466706_146255 | 3300042599 | Bacteria | 2532 |
| 45 | Ga0466716_204755 | 3300042605 | Bacteria | 2775 |
| 46 | Ga0466720_200085 | 3300042607 | Bacteria | 3023 |
| 47 | Ga0123357_10383433 | 3300009784 | Bacteria | 1301 |
| 48 | Ga0123356_10011088 | 3300010049 | Bacteria | 8802 |
| 49 | Ga0415639_096341 | 3300038395 | Bacteria | 1928 |
| 50 | Ga0415639_112255 | 3300038395 | Bacteria | 1806 |
| 51 | Ga0466712_026949 | 3300042614 | Bacteria | 25702 |
| 52 | Ga0466718_005106 | 3300042617 | Bacteria | 8688 |
| 53 | Ga0466726_113305 | 3300042619 | Bacteria | 2416 |
| 54 | JGI24695J34938_10008960 | 3300002450 | Bacteria | 5632 |
| 55 | Ga0072941_1017012 | 3300005201 | Bacteria | 26385 |
| 56 | Ga0466702_191272 | 3300042635 | Bacteria | 19326 |
| 57 | Ga0466702_222843 | 3300042635 | Bacteria | 2227 |
| 58 | Ga0466703_184397 | 3300042636 | Bacteria | 29696 |
| 59 | Ga0466727_129411 | 3300042655 | Bacteria | 1075 |
| 60 | Ga0123356_10590277 | 3300010049 | Bacteria | 1275 |
| 61 | Ga0466693_245129 | 3300042592 | Bacteria | 4822 |
| 62 | Ga0466691_202107 | 3300042593 | Bacteria | 1736 |
| 63 | Ga0466712_103661 | 3300042614 | Bacteria | 3246 |
| 64 | Ga0466712_195101 | 3300042614 | Bacteria | 17668 |
| 65 | Ga0466712_209554 | 3300042614 | Bacteria | 30568 |
| 66 | Ga0466718_045827 | 3300042617 | Bacteria | 2349 |
| 67 | Ga0466726_007434 | 3300042619 | Bacteria | 2062 |
| 68 | Ga0466726_308136 | 3300042619 | Bacteria | 20107 |
| 69 | JGI24698J34947_10028731 | 3300002449 | Bacteria | 2943 |
| 70 | JGI24695J34938_10000043 | 3300002450 | Bacteria | 94696 |
| 71 | JGI24695J34938_10063482 | 3300002450 | Bacteria | 1566 |
| 72 | Ga0072940_1035794 | 3300005200 | Unclassified | 16352 |
| 73 | Ga0466705_320763 | 3300042612 | Unclassified | 1709 |
| 74 | Ga0466703_368682 | 3300042636 | Bacteria | 10825 |
| 75 | Ga0466701_046220 | 3300042598 | Bacteria | 1788 |
| 76 | Ga0466707_157034 | 3300042601 | Bacteria | 1176 |
| 77 | Ga0466716_217031 | 3300042605 | Bacteria | 15553 |
| 78 | Ga0466719_264379 | 3300042606 | Bacteria | 14167 |
| 79 | Ga0466721_369620 | 3300042608 | Bacteria | 1361 |
| 80 | Ga0123356_10054077 | 3300010049 | Bacteria | 3739 |
| 81 | Ga0123356_10373912 | 3300010049 | Bacteria | 1556 |
| 82 | Ga0466696_132666 | 3300042596 | Bacteria | 40772 |
| 83 | Ga0466699_002729 | 3300042597 | Bacteria | 17818 |
| 84 | Ga0466699_237898 | 3300042597 | Bacteria | 13519 |
| 85 | Ga0466712_042613 | 3300042614 | Bacteria | 8996 |
| 86 | Ga0466712_212989 | 3300042614 | Bacteria | 4839 |
| 87 | Ga0466718_106017 | 3300042617 | Bacteria | 1333 |
| 88 | JGI24698J34947_10001586 | 3300002449 | Bacteria | 12059 |
| 89 | JGI24695J34938_10073674 | 3300002450 | Unclassified | 1422 |
| 90 | JGI24702J35022_10037220 | 3300002462 | Bacteria | 2599 |
| 91 | Ga0466702_212593 | 3300042635 | Bacteria | 3099 |
| 92 | Ga0466704_513106 | 3300042643 | Bacteria | 10178 |
| 93 | Ga0466727_305303 | 3300042655 | Bacteria | 3491 |
| 94 | Ga0123356_10197961 | 3300010049 | Bacteria | 2046 |
| 95 | Ga0123356_11477894 | 3300010049 | Bacteria | 838 |
| 96 | Ga0264413_117748 | 3300024493 | Bacteria | 13996 |
| 97 | Ga0415639_044136 | 3300038395 | Bacteria | 1670 |
| 98 | Ga0466712_250011 | 3300042614 | Bacteria | 13067 |
| 99 | Ga0466715_007526 | 3300042616 | Bacteria | 13580 |
| 100 | Ga0466718_005447 | 3300042617 | Unclassified | 2351 |
| 101 | Ga0466723_122308 | 3300042618 | Bacteria | 3144 |
| 102 | Ga0466726_036320 | 3300042619 | Bacteria | 3194 |
| 103 | Ga0466726_113151 | 3300042619 | Bacteria | 1667 |
| 104 | Ga0466726_325124 | 3300042619 | Bacteria | 1183 |
| 105 | JGI24698J34947_10109505 | 3300002449 | Bacteria | 1222 |
| 106 | JGI24695J34938_10005692 | 3300002450 | Bacteria | 7692 |
| 107 | JGI24695J34938_10006223 | 3300002450 | Bacteria | 7243 |
| 108 | JGI24695J34938_10008137 | 3300002450 | Bacteria | 6033 |
| 109 | JGI24695J34938_10023665 | 3300002450 | Bacteria | 2958 |
| 110 | Ga0466735_053338 | 3300042624 | Bacteria | 3811 |
| 111 | Ga0466708_110202 | 3300042652 | Bacteria | 2496 |
| 112 | Ga0466725_179559 | 3300042654 | Bacteria | 1893 |
| 113 | Ga0466707_265469 | 3300042601 | Bacteria | 1100 |
| 114 | Ga0466722_033280 | 3300042609 | Bacteria | 4644 |
| 115 | Ga0255786_1011261 | 3300022815 | Bacteria | 1459 |
| 116 | Ga0415639_008727 | 3300038395 | Bacteria | 8161 |
| 117 | Ga0466694_386038 | 3300042594 | Bacteria | 5704 |
| 118 | Ga0466695_151841 | 3300042595 | Bacteria | 41232 |
| 119 | Ga0466699_107108 | 3300042597 | Bacteria | 2688 |
| 120 | AustNasuHG_c1014124 | 3300000089 | Bacteria | 2724 |
| 121 | JGI24698J34947_10002936 | 3300002449 | Bacteria | 9250 |
| 122 | JGI24698J34947_10090189 | 3300002449 | Bacteria | 1409 |
| 123 | JGI24695J34938_10000019 | 3300002450 | Bacteria | 113818 |
| 124 | JGI24695J34938_10001483 | 3300002450 | Bacteria | 19815 |
| 125 | Ga0072941_1074770 | 3300005201 | Bacteria | 6066 |
| 126 | Ga0466702_266044 | 3300042635 | Bacteria | 5465 |
| 127 | Ga0466719_306189 | 3300042606 | Bacteria | 27346 |
| 128 | Ga0123355_10071765 | 3300009826 | Bacteria | 5557 |
| 129 | Ga0123356_10000565 | 3300010049 | Bacteria | 41206 |
| 130 | Ga0466712_076106 | 3300042614 | Bacteria | 3700 |
| 131 | Ga0466715_065478 | 3300042616 | Bacteria | 25951 |
| 132 | JGI24695J34938_10000763 | 3300002450 | Bacteria | 30255 |
| 133 | JGI24695J34938_10006628 | 3300002450 | Bacteria | 6911 |
| 134 | JGI24695J34938_10022443 | 3300002450 | Bacteria | 3065 |
| 135 | JGI24695J34938_10199601 | 3300002450 | Unclassified | 833 |
| 136 | Ga0072940_1003991 | 3300005200 | Bacteria | 5890 |
| 137 | Ga0466704_088620 | 3300042643 | Bacteria | 2579 |
| 138 | Ga0466704_122052 | 3300042643 | Bacteria | 8173 |
| 139 | Ga0466727_074740 | 3300042655 | Bacteria | 2664 |
| 140 | Ga0466727_219047 | 3300042655 | Bacteria | 1202 |
| 141 | Ga0466727_237782 | 3300042655 | Bacteria | 1653 |
| 142 | Ga0466701_078199 | 3300042598 | Bacteria | 1046 |
| 143 | Ga0466706_261925 | 3300042599 | Bacteria | 1508 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01765 | RRF | Ribosome recycling factor | 13 | 168 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.