Protein Family IF05364

Metagenome Isolate
150 Members
38 Samples
139 Scaffolds
184.65 Avg Length

🧬 Representative Sequence

ID
3300042597|Ga0466699_350271|Ga0466699_350271_391_966
Length
191 aa
Sequence
MKLIRRLIMNETLKTIAGRYSCRDFTGAPLTAGQVKALAEAAMASPSAMNRQPWHVIVITDKALIDELDAEGMKILVAADDRSAYERIMSRGGKLFYNAPCMVIAATADSAAMDCGILSQNVALAAHSLGLGNVICGLAGVPFSGPKGGDFKKRLKFPEGYGFGIAVLAGAAKSAAEPHKLDTAKVTFIEA

📊 Sample Types

Isolate 7.3%
Metagenome 92.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 67.6%
Unclassified 27.0%
Kalotermitidae 2.7%
Hodotermitidae 2.7%

🌳 Taxonomy

Archaea 0
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
4 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
7 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
8 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
9 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
10 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
11 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
12 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
13 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
14 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
15 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
16 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
17 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
18 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 2820856540 Unclassified Actinobacteria Lab288P3bin21 Isolate Unclassified
23 2820438595 Unclassified Firmicutes Lab288P3bin208 Isolate Unclassified
24 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
25 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
26 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
27 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
28 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
31 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
32 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
33 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
34 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
35 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
36 2820323050 Unclassified Firmicutes Nt197P3bin84 Isolate Unclassified
37 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
38 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_250323 3300042611 Unclassified 2270
2 Ga0123355_10002008 3300009826 Bacteria 28776
3 Ga0123355_10303401 3300009826 Bacteria 2174
4 Ga0123356_10512936 3300010049 Bacteria 1356
5 Ga0123356_10552334 3300010049 Bacteria 1313
6 Ga0123353_10010155 3300010167 Bacteria 13093
7 Ga0123353_10157661 3300010167 Bacteria 3616
8 Ga0466712_104784 3300042614 Bacteria 5036
9 Ga0466718_082154 3300042617 Bacteria 1731
10 JGI24698J34947_10033133 3300002449 Unclassified 2711
11 Ga0072941_1021540 3300005201 Bacteria 7283
12 Ga0072941_1025954 3300005201 Bacteria 1510
13 Ga0072941_1089053 3300005201 Bacteria 1561
14 Ga0072941_1221651 3300005201 Bacteria 991
15 Ga0466698_237245 3300042610 Bacteria 20663
16 Ga0466695_362807 3300042595 Bacteria 1075
17 Ga0466699_029209 3300042597 Bacteria 1473
18 Ga0466699_090470 3300042597 Bacteria 32029
19 Ga0466699_098257 3300042597 Bacteria 2854
20 Ga0466699_141196 3300042597 Bacteria 4361
21 Ga0466699_296218 3300042597 Bacteria 1512
22 Ga0466699_407156 3300042597 Bacteria 1046
23 Ga0466699_427739 3300042597 Bacteria 2827
24 Ga0466732_392154 3300042656 Bacteria 1090
25 Ga0466733_112459 3300042659 Unclassified 1600
26 Ga0123355_10079025 3300009826 Bacteria 5255
27 Ga0123355_10087545 3300009826 Bacteria 4949
28 Ga0123353_10083814 3300010167 Bacteria 5131
29 JGI24698J34947_10004673 3300002449 Bacteria 7470
30 JGI24695J34938_10016690 3300002450 Bacteria 3725
31 Ga0466700_319703 3300042600 Bacteria 1635
32 Ga0466721_279986 3300042608 Bacteria 4381
33 Ga0466696_501968 3300042596 Bacteria 3436
34 Ga0466699_017621 3300042597 Bacteria 1434
35 Ga0466699_282582 3300042597 Bacteria 2745
36 Ga0466699_303162 3300042597 Bacteria 6870
37 Ga0123356_10782068 3300010049 Bacteria 1125
38 Ga0123353_10058021 3300010167 Bacteria 6201
39 Ga0123353_10506877 3300010167 Bacteria 1756
40 Ga0123353_11089450 3300010167 Bacteria 1062
41 Ga0123353_11296470 3300010167 Bacteria 946
42 Ga0123354_10109582 3300010882 Bacteria 3657
43 Ga0466712_323683 3300042614 Bacteria 1215
44 Ga0466718_149161 3300042617 Bacteria 41124
45 JGI24698J34947_10011846 3300002449 Unclassified 4788
46 Ga0466699_155279 3300042597 Unclassified 5233
47 Ga0466699_164074 3300042597 Bacteria 6983
48 Ga0466734_152721 3300042623 Bacteria 1185
49 Ga0123357_10655675 3300009784 Bacteria 774
50 Ga0123355_10319329 3300009826 Bacteria 2095
51 Ga0123356_10553244 3300010049 Bacteria 1312
52 Ga0123353_10171308 3300010167 Bacteria 3445
53 Ga0123353_10788118 3300010167 Bacteria 1315
54 Ga0123353_10904377 3300010167 Bacteria 1201
55 Ga0123354_10520418 3300010882 Bacteria 914
56 Ga0466712_010603 3300042614 Unclassified 9134
57 Ga0466712_049565 3300042614 Bacteria 6184
58 Ga0466718_101988 3300042617 Bacteria 1484
59 JGI24698J34947_10030426 3300002449 Bacteria 2847
60 JGI24698J34947_10118359 3300002449 Bacteria 1155
61 Ga0415639_140933 3300038395 Bacteria 2306
62 Ga0415639_155853 3300038395 Bacteria 1187
63 Ga0466702_412886 3300042635 Bacteria 7288
64 Ga0123355_10000002 3300009826 Bacteria 241009
65 Ga0123355_10390707 3300009826 Bacteria 1804
66 Ga0123356_10141324 3300010049 Bacteria 2375
67 Ga0123356_10220660 3300010049 Bacteria 1952
68 Ga0123353_10085091 3300010167 Bacteria 5091
69 Ga0123353_10116355 3300010167 Bacteria 4302
70 Ga0123353_10230311 3300010167 Bacteria 2889
71 JGI24698J34947_10008540 3300002449 Bacteria 5623
72 JGI24698J34947_10048432 3300002449 Unclassified 2153
73 JGI24698J34947_10148845 3300002449 Bacteria 975
74 JGI24697J35500_11229457 3300002507 Bacteria 2010
75 Ga0072941_1021571 3300005201 Bacteria 7739
76 Ga0466699_232162 3300042597 Unclassified 3449
77 Ga0466699_329176 3300042597 Bacteria 10503
78 Ga0466699_354933 3300042597 Bacteria 2108
79 Ga0123355_10010334 3300009826 Bacteria 14291
80 Ga0123356_10045597 3300010049 Bacteria 4079
81 Ga0123356_10245094 3300010049 Bacteria 1866
82 Ga0123356_10759937 3300010049 Bacteria 1140
83 Ga0123356_11312501 3300010049 Bacteria 887
84 Ga0123356_11357112 3300010049 Bacteria 873
85 Ga0123356_11522559 3300010049 Bacteria 826
86 Ga0123356_12537194 3300010049 Bacteria 642
87 Ga0123353_10238380 3300010167 Bacteria 2828
88 Ga0123353_10725182 3300010167 Bacteria 1389
89 Ga0123353_11081426 3300010167 Bacteria 1067
90 Ga0123353_11168150 3300010167 Bacteria 1014
91 Ga0466712_030268 3300042614 Bacteria 2183
92 Ga0466712_072064 3300042614 Bacteria 1683
93 Ga0466712_138310 3300042614 Bacteria 9720
94 Ga0466712_194840 3300042614 Bacteria 2121
95 JGI24698J34947_10008467 3300002449 Bacteria 5648
96 JGI24698J34947_10017046 3300002449 Unclassified 3940
97 JGI24698J34947_10019175 3300002449 Bacteria 3694
98 JGI24702J35022_10255418 3300002462 Bacteria 1021
99 Ga0466714_047757 3300042603 Bacteria 59393
100 Ga0466721_143311 3300042608 Bacteria 30100
101 Ga0466699_169486 3300042597 Bacteria 2588
102 Ga0466699_211602 3300042597 Bacteria 1786
103 Ga0466699_224111 3300042597 Bacteria 5510
104 Ga0466699_384793 3300042597 Bacteria 1909
105 Ga0466702_351479 3300042635 Bacteria 3690
106 Ga0123355_11008204 3300009826 Unclassified 883
107 Ga0123356_10020199 3300010049 Bacteria 6305
108 Ga0123353_10405264 3300010167 Bacteria 2028
109 Ga0123353_11215718 3300010167 Bacteria 987
110 Ga0466712_032594 3300042614 Bacteria 17646
111 Ga0466718_083872 3300042617 Bacteria 20745
112 JGI24702J35022_10404979 3300002462 Unclassified 824
113 Ga0072941_1108075 3300005201 Bacteria 1044
114 Ga0415639_141180 3300038395 Bacteria 1667
115 Ga0466699_147011 3300042597 Bacteria 23668
116 Ga0466699_270234 3300042597 Bacteria 1959
117 Ga0466699_350271 3300042597 Bacteria 1068
118 Ga0466699_391609 3300042597 Bacteria 17246
119 Ga0466725_287846 3300042654 Bacteria 1334
120 Ga0123355_10680291 3300009826 Bacteria 1189
121 Ga0123353_10327026 3300010167 Bacteria 2323
122 Ga0123354_10186051 3300010882 Unclassified 2349
123 Ga0123354_10225390 3300010882 Bacteria 1977
124 Ga0123354_10367000 3300010882 Bacteria 1261
125 Ga0466712_028943 3300042614 Bacteria 6316
126 Ga0466712_041036 3300042614 Bacteria 12008
127 Ga0466718_052225 3300042617 Bacteria 1311
128 Ga0466718_151009 3300042617 Bacteria 8061
129 JGI24698J34947_10003686 3300002449 Bacteria 8331
130 JGI24698J34947_10010072 3300002449 Bacteria 5180
131 JGI24698J34947_10017428 3300002449 Bacteria 3892
132 Ga0072941_1040985 3300005201 Bacteria 2591
133 Ga0466706_041712 3300042599 Bacteria 4059
134 Ga0415639_001037 3300038395 Bacteria 30072
135 Ga0415639_017842 3300038395 Bacteria 36038
136 Ga0466656_033592 3300042550 Bacteria 1099
137 Ga0466699_181238 3300042597 Bacteria 1855
138 Ga0466702_066825 3300042635 Bacteria 1838
139 Ga0466702_230939 3300042635 Bacteria 1042

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00881 Nitroreductase Nitroreductase family 16 137 0.92

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.