Protein Family IF05356
Metagenome
Metatranscriptome
Isolate
139
Members
40
Samples
133
Scaffolds
158.57
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_307954|Ga0466699_307954_8803_9381
- Length
- 192 aa
- Sequence
- MLNLPLPLYVGYYKNTGIYHILGTIYRVGYRRYHNMRCPHCGSIDDKVIDSRTLANGEAIRRRRECERCGYRFTSYERTEDKQFMVIKKDGRREPFDRDKIERGIERALEKRPVSQMQIENMVNDIEDKAAILSKGNREIECRIIGDLILEQLGIIDKVAYIRFASVYRQFENLDEFIQEIHLLGGEQSSGT
Sample Types
Isolate
4.3%
Metagenome
95.0%
MAG
0.0%
Metatranscriptome
0.7%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Kalotermitidae
23.7%
Unclassified
15.8%
Rhinotermitidae
7.9%
Termopsidae
2.6%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 16 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 26 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 27 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 28 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 29 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 30 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 31 | 3300021218 | Termite gut microbial communities from nest from French Guiana - FG16_L2_4 mRNA SA | Metatranscriptome | |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 34 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 35 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 36 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 37 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 38 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466700_158414 | 3300042600 | Bacteria | 1922 |
| 2 | Ga0466700_180538 | 3300042600 | Bacteria | 1015 |
| 3 | Ga0466720_022529 | 3300042607 | Bacteria | 3371 |
| 4 | Ga0466720_069084 | 3300042607 | Bacteria | 9966 |
| 5 | Ga0466720_210761 | 3300042607 | Bacteria | 15962 |
| 6 | Ga0466722_019160 | 3300042609 | Bacteria | 6194 |
| 7 | Ga0466722_037654 | 3300042609 | Bacteria | 16488 |
| 8 | Ga0223679_133432 | 3300021218 | Bacteria | 685 |
| 9 | Ga0466699_025735 | 3300042597 | Bacteria | 3960 |
| 10 | Ga0466699_119128 | 3300042597 | Bacteria | 4244 |
| 11 | Ga0466699_157535 | 3300042597 | Bacteria | 1060 |
| 12 | Ga0466699_307954 | 3300042597 | Bacteria | 13307 |
| 13 | JGI24699J35502_11126624 | 3300002509 | Bacteria | 3995 |
| 14 | Ga0123356_10715728 | 3300010049 | Bacteria | 1170 |
| 15 | Ga0123353_10982212 | 3300010167 | Bacteria | 1137 |
| 16 | Ga0123353_11145604 | 3300010167 | Bacteria | 1027 |
| 17 | Ga0466705_029450 | 3300042612 | Bacteria | 13047 |
| 18 | Ga0466712_030109 | 3300042614 | Bacteria | 1815 |
| 19 | Ga0466712_110777 | 3300042614 | Bacteria | 1136 |
| 20 | Ga0466715_307683 | 3300042616 | Bacteria | 5755 |
| 21 | Ga0466718_152456 | 3300042617 | Unclassified | 2949 |
| 22 | Ga0466700_334737 | 3300042600 | Bacteria | 1182 |
| 23 | Ga0466720_005522 | 3300042607 | Bacteria | 1274 |
| 24 | Ga0466720_026656 | 3300042607 | Bacteria | 7969 |
| 25 | Ga0466694_118931 | 3300042594 | Bacteria | 1742 |
| 26 | Ga0466696_284686 | 3300042596 | Bacteria | 9944 |
| 27 | Ga0466699_161983 | 3300042597 | Bacteria | 13467 |
| 28 | JGI24698J34947_10001921 | 3300002449 | Bacteria | 11065 |
| 29 | JGI24698J34947_10050639 | 3300002449 | Bacteria | 2093 |
| 30 | JGI24705J35276_12221344 | 3300002504 | Bacteria | 2334 |
| 31 | Ga0123356_10346741 | 3300010049 | Bacteria | 1607 |
| 32 | Ga0123356_10473621 | 3300010049 | Unclassified | 1404 |
| 33 | Ga0123353_11156526 | 3300010167 | Bacteria | 1021 |
| 34 | Ga0466704_223677 | 3300042643 | Bacteria | 60624 |
| 35 | Ga0466718_042183 | 3300042617 | Bacteria | 62729 |
| 36 | Ga0466722_223940 | 3300042609 | Bacteria | 6002 |
| 37 | Ga0466692_011062 | 3300042591 | Bacteria | 1882 |
| 38 | JGI24698J34947_10014090 | 3300002449 | Unclassified | 4355 |
| 39 | JGI24695J34938_10169410 | 3300002450 | Bacteria | 900 |
| 40 | JGI24705J35276_12158497 | 3300002504 | Bacteria | 1219 |
| 41 | Ga0466732_161233 | 3300042656 | Bacteria | 28180 |
| 42 | Ga0466712_248752 | 3300042614 | Bacteria | 4553 |
| 43 | Ga0466718_068717 | 3300042617 | Bacteria | 2023 |
| 44 | Ga0466719_144372 | 3300042606 | Unclassified | 4195 |
| 45 | Ga0466720_007307 | 3300042607 | Unclassified | 1441 |
| 46 | Ga0466722_143235 | 3300042609 | Bacteria | 3869 |
| 47 | Ga0466722_182285 | 3300042609 | Bacteria | 1833 |
| 48 | Ga0466722_202458 | 3300042609 | Bacteria | 3634 |
| 49 | Ga0466696_037040 | 3300042596 | Bacteria | 1807 |
| 50 | JGI24698J34947_10036730 | 3300002449 | Bacteria | 2550 |
| 51 | JGI24698J34947_10054231 | 3300002449 | Bacteria | 2003 |
| 52 | JGI24702J35022_10003857 | 3300002462 | Bacteria | 8996 |
| 53 | Ga0072941_1178028 | 3300005201 | Bacteria | 1420 |
| 54 | Ga0123356_10097820 | 3300010049 | Bacteria | 2809 |
| 55 | Ga0466712_029559 | 3300042614 | Bacteria | 21198 |
| 56 | Ga0466712_126441 | 3300042614 | Bacteria | 83990 |
| 57 | Ga0466712_253640 | 3300042614 | Unclassified | 2160 |
| 58 | Ga0466718_163222 | 3300042617 | Bacteria | 3561 |
| 59 | Ga0466716_483865 | 3300042605 | Bacteria | 3913 |
| 60 | Ga0466720_139545 | 3300042607 | Bacteria | 10773 |
| 61 | Ga0466692_068217 | 3300042591 | Bacteria | 3298 |
| 62 | Ga0466699_111726 | 3300042597 | Bacteria | 1839 |
| 63 | Ga0466699_139912 | 3300042597 | Bacteria | 31344 |
| 64 | Ga0466699_222415 | 3300042597 | Unclassified | 2566 |
| 65 | Ga0466699_377719 | 3300042597 | Bacteria | 1399 |
| 66 | Ga0466699_430418 | 3300042597 | Unclassified | 1187 |
| 67 | JGI24698J34947_10000768 | 3300002449 | Bacteria | 15907 |
| 68 | JGI24698J34947_10002529 | 3300002449 | Bacteria | 9868 |
| 69 | JGI24698J34947_10010269 | 3300002449 | Bacteria | 5134 |
| 70 | JGI24695J34938_10005104 | 3300002450 | Unclassified | 8329 |
| 71 | JGI24695J34938_10052369 | 3300002450 | Bacteria | 1781 |
| 72 | Ga0123356_10006220 | 3300010049 | Bacteria | 12066 |
| 73 | Ga0123353_10149932 | 3300010167 | Bacteria | 3724 |
| 74 | Ga0466705_362516 | 3300042612 | Bacteria | 2172 |
| 75 | Ga0466732_165350 | 3300042656 | Bacteria | 14794 |
| 76 | Ga0466712_082701 | 3300042614 | Bacteria | 2495 |
| 77 | Ga0466712_210897 | 3300042614 | Unclassified | 1508 |
| 78 | Ga0466715_488895 | 3300042616 | Bacteria | 1675 |
| 79 | Ga0466720_017925 | 3300042607 | Bacteria | 11697 |
| 80 | Ga0466690_045368 | 3300042590 | Bacteria | 6022 |
| 81 | Ga0466692_109939 | 3300042591 | Unclassified | 3485 |
| 82 | Ga0466694_322768 | 3300042594 | Bacteria | 1220 |
| 83 | Ga0466699_155878 | 3300042597 | Bacteria | 1355 |
| 84 | Ga0466699_284721 | 3300042597 | Unclassified | 3859 |
| 85 | Ga0466699_285237 | 3300042597 | Bacteria | 18487 |
| 86 | Nasutiter_Contig25446 | 2030936001 | Bacteria | 694 |
| 87 | JGI24698J34947_10004811 | 3300002449 | Bacteria | 7385 |
| 88 | JGI24698J34947_10033951 | 3300002449 | Bacteria | 2673 |
| 89 | JGI24698J34947_10035155 | 3300002449 | Bacteria | 2618 |
| 90 | JGI24698J34947_10123396 | 3300002449 | Bacteria | 1120 |
| 91 | JGI24698J34947_10197660 | 3300002449 | Unclassified | 790 |
| 92 | JGI24698J34947_10228741 | 3300002449 | Unclassified | 708 |
| 93 | Ga0072941_1116176 | 3300005201 | Bacteria | 4533 |
| 94 | Ga0123356_10950084 | 3300010049 | Bacteria | 1030 |
| 95 | Ga0466732_427962 | 3300042656 | Unclassified | 1723 |
| 96 | Ga0466704_336844 | 3300042643 | Bacteria | 8938 |
| 97 | Ga0466705_525539 | 3300042612 | Bacteria | 1300 |
| 98 | Ga0466712_200407 | 3300042614 | Unclassified | 8067 |
| 99 | Ga0466716_236629 | 3300042605 | Bacteria | 1311 |
| 100 | Ga0466720_113070 | 3300042607 | Bacteria | 1930 |
| 101 | Ga0466698_138947 | 3300042610 | Bacteria | 1593 |
| 102 | Ga0466693_041452 | 3300042592 | Bacteria | 38277 |
| 103 | Ga0466693_273847 | 3300042592 | Bacteria | 5074 |
| 104 | Ga0466699_190220 | 3300042597 | Bacteria | 1281 |
| 105 | Ga0466699_197501 | 3300042597 | Bacteria | 1714 |
| 106 | Ga0466699_392303 | 3300042597 | Bacteria | 1086 |
| 107 | JGI24702J35022_10017206 | 3300002462 | Bacteria | 3953 |
| 108 | Ga0072941_1064225 | 3300005201 | Bacteria | 3738 |
| 109 | Ga0074263_117328 | 3300005485 | Bacteria | 900 |
| 110 | Ga0123355_10447988 | 3300009826 | Bacteria | 1629 |
| 111 | Ga0123356_10957557 | 3300010049 | Bacteria | 1027 |
| 112 | Ga0466732_033622 | 3300042656 | Unclassified | 1969 |
| 113 | Ga0466713_093626 | 3300042602 | Bacteria | 2346 |
| 114 | Ga0466720_186545 | 3300042607 | Unclassified | 1019 |
| 115 | Ga0466698_050209 | 3300042610 | Bacteria | 1818 |
| 116 | Ga0456237_0010953 | 3300041968 | Bacteria | 1332 |
| 117 | Ga0466690_003709 | 3300042590 | Bacteria | 1538 |
| 118 | Ga0466694_192594 | 3300042594 | Bacteria | 1301 |
| 119 | Ga0466699_001752 | 3300042597 | Bacteria | 1327 |
| 120 | Ga0466699_161885 | 3300042597 | Bacteria | 3744 |
| 121 | Ga0466699_184813 | 3300042597 | Bacteria | 1719 |
| 122 | JGI24698J34947_10024243 | 3300002449 | Bacteria | 3241 |
| 123 | JGI24698J34947_10068931 | 3300002449 | Unclassified | 1708 |
| 124 | JGI24698J34947_10114815 | 3300002449 | Bacteria | 1181 |
| 125 | JGI24698J34947_10190349 | 3300002449 | Bacteria | 812 |
| 126 | Ga0123353_10329460 | 3300010167 | Bacteria | 2312 |
| 127 | Ga0123353_10637128 | 3300010167 | Bacteria | 1513 |
| 128 | Ga0466732_044923 | 3300042656 | Bacteria | 1380 |
| 129 | Ga0466704_609914 | 3300042643 | Unclassified | 16061 |
| 130 | Ga0466705_480790 | 3300042612 | Bacteria | 5701 |
| 131 | Ga0466718_047515 | 3300042617 | Bacteria | 14989 |
| 132 | Ga0466723_145743 | 3300042618 | Bacteria | 34862 |
| 133 | Ga0466726_385470 | 3300042619 | Bacteria | 1155 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.