Protein Family IF05303
Metagenome
Isolate
319
Members
112
Samples
265
Scaffolds
327.21
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_128415|Ga0466699_128415_453_1571
- Length
- 372 aa
- Sequence
- MKNEERKMKXXXRPHAETRGRRGRREEGGILIPLSSASPRLRVLKFGLMLSVITAVLIFAGCGGKKVDDNLIRVVLDWTPNTNHTGLYVALEKGWFAEEGMKVTMIQPPEDGALVLVGSGGAEFGFDFQESMGPAIAKDRDTLPVIAVAAIISHNTSGIMSLANSGINSPRDLMGKRFGSWETPLVTALIREIVENDGGNFAEVEMIPNFAMDAFSALKTDLDAIWIYYAWDGIAAEVNGIDINYIDFGSLDRRFDFYTPILAANTGWLDANPETAKKFLRAAKRGYEFAIENPWEAAEILLKHAPELDRKLVVESQEYLQTRYQDDAPRWGEIDPXXXXDFYTWMYERGLLEKNIGAGGFTNEYLPMSNEQ
Sample Types
Isolate
16.9%
Metagenome
83.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
31.2%
Termitidae
24.8%
Kalotermitidae
12.8%
Blattidae
7.3%
Apidae
5.5%
Tenebrionidae
2.8%
Rhinotermitidae
2.8%
Culicidae
2.8%
Termopsidae
2.8%
Hydrophilidae
1.8%
Hodotermitidae
0.9%
Penaeidae
0.9%
Scarabaeidae
0.9%
Noctuidae
0.9%
Drosophilidae
0.9%
Reduviidae
0.9%
Taxonomy
Archaea
0
Bacteria
312
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 2 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 3 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 6 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 13 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 14 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 15 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 23 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 24 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 25 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 26 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 27 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 28 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 29 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 36 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 37 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 38 | 2820641689 | Unclassified Firmicutes Cu122P5bin5 | Isolate | Unclassified |
| 39 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 40 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 41 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 42 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 43 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 44 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 45 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 46 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 47 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 48 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 49 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 50 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 51 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 52 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 53 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 54 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 55 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 56 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 57 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 58 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 59 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 60 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 61 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 62 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 63 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 64 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 65 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 66 | 2820369699 | Unclassified Firmicutes Nt197P3bin103 | Isolate | Unclassified |
| 67 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 68 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 69 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 70 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 71 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 72 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 73 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 74 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 75 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 76 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 77 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 78 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 79 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 80 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 81 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 82 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 83 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 84 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 85 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 86 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 87 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 88 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 89 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 90 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 91 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 92 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 93 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 94 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 95 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 96 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 97 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 98 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 99 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 100 | 2545824723 | Rhodococcus rhodnii LMG 5362 | Isolate | Reduviidae |
| 101 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 102 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 103 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 104 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 105 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 106 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 107 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 108 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 109 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 110 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 111 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 112 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24695J34938_10000018 | 3300002450 | Bacteria | 115524 |
| 2 | JGI24695J34938_10009286 | 3300002450 | Bacteria | 5482 |
| 3 | Ga0072941_1064924 | 3300005201 | Bacteria | 12140 |
| 4 | Ga0466732_096575 | 3300042656 | Bacteria | 1180 |
| 5 | Ga0123355_10053776 | 3300009826 | Bacteria | 6527 |
| 6 | Ga0123354_10063861 | 3300010882 | Bacteria | 5406 |
| 7 | Ga0466712_267067 | 3300042614 | Bacteria | 18400 |
| 8 | Ga0466715_490126 | 3300042616 | Bacteria | 8388 |
| 9 | Ga0466723_032334 | 3300042618 | Bacteria | 5005 |
| 10 | Ga0466726_490682 | 3300042619 | Bacteria | 1442 |
| 11 | Ga0160440_100013 | 3300012815 | Bacteria | 344440 |
| 12 | Ga0466690_210867 | 3300042590 | Bacteria | 1452 |
| 13 | Ga0466691_103344 | 3300042593 | Bacteria | 9360 |
| 14 | Ga0466694_011369 | 3300042594 | Bacteria | 16469 |
| 15 | Ga0466694_082150 | 3300042594 | Bacteria | 1089 |
| 16 | Ga0466703_026598 | 3300042636 | Bacteria | 6102 |
| 17 | Ga0466704_070657 | 3300042643 | Bacteria | 46098 |
| 18 | Ga0466704_081722 | 3300042643 | Bacteria | 3718 |
| 19 | Ga0466704_474961 | 3300042643 | Bacteria | 3471 |
| 20 | Ga0466709_297537 | 3300042648 | Bacteria | 19155 |
| 21 | Ga0466708_273384 | 3300042652 | Bacteria | 20323 |
| 22 | Ga0466727_191660 | 3300042655 | Bacteria | 1519 |
| 23 | Ga0466700_473910 | 3300042600 | Bacteria | 2840 |
| 24 | Ga0466707_197196 | 3300042601 | Bacteria | 1144 |
| 25 | AustNasuHG_c1010280 | 3300000089 | Bacteria | 3265 |
| 26 | JGI24695J34938_10001536 | 3300002450 | Bacteria | 19468 |
| 27 | JGI24695J34938_10003649 | 3300002450 | Bacteria | 10565 |
| 28 | JGI24695J34938_10009435 | 3300002450 | Bacteria | 5425 |
| 29 | Ga0072940_1303845 | 3300005200 | Bacteria | 2754 |
| 30 | Ga0466732_049624 | 3300042656 | Bacteria | 8942 |
| 31 | Ga0466732_226761 | 3300042656 | Bacteria | 3185 |
| 32 | Ga0562379_0011 | 3300056790 | Bacteria | 1623141 |
| 33 | Ga0123356_10003335 | 3300010049 | Bacteria | 16854 |
| 34 | Ga0123356_10017254 | 3300010049 | Bacteria | 6871 |
| 35 | Ga0123356_10452843 | 3300010049 | Bacteria | 1432 |
| 36 | Ga0466705_514936 | 3300042612 | Bacteria | 3470 |
| 37 | Ga0466712_067191 | 3300042614 | Bacteria | 7263 |
| 38 | Ga0466712_288234 | 3300042614 | Bacteria | 10759 |
| 39 | Ga0466715_147076 | 3300042616 | Bacteria | 4537 |
| 40 | Ga0466718_102356 | 3300042617 | Bacteria | 1294 |
| 41 | Ga0466726_336341 | 3300042619 | Bacteria | 3090 |
| 42 | Ga0160458_101275 | 3300012832 | Bacteria | 5128 |
| 43 | Ga0160436_1003013 | 3300012861 | Unclassified | 4185 |
| 44 | Ga0466690_001535 | 3300042590 | Bacteria | 4308 |
| 45 | Ga0466690_135940 | 3300042590 | Bacteria | 2528 |
| 46 | Ga0466690_286761 | 3300042590 | Bacteria | 1022 |
| 47 | Ga0466691_066400 | 3300042593 | Bacteria | 7678 |
| 48 | Ga0466694_006347 | 3300042594 | Bacteria | 12968 |
| 49 | Ga0466694_107089 | 3300042594 | Bacteria | 1386 |
| 50 | Ga0466694_250707 | 3300042594 | Bacteria | 2266 |
| 51 | Ga0466696_437423 | 3300042596 | Bacteria | 2808 |
| 52 | Ga0466699_122531 | 3300042597 | Bacteria | 5991 |
| 53 | Ga0466735_203788 | 3300042624 | Bacteria | 2078 |
| 54 | Ga0466703_149019 | 3300042636 | Bacteria | 5631 |
| 55 | Ga0466706_260081 | 3300042599 | Bacteria | 1524 |
| 56 | Ga0466713_001856 | 3300042602 | Bacteria | 53670 |
| 57 | Ga0466705_167004 | 3300042612 | Bacteria | 9740 |
| 58 | JGI24698J34947_10016567 | 3300002449 | Bacteria | 3998 |
| 59 | JGI24695J34938_10020387 | 3300002450 | Bacteria | 3262 |
| 60 | Ga0072940_1000918 | 3300005200 | Bacteria | 11876 |
| 61 | Ga0072940_1093424 | 3300005200 | Bacteria | 2152 |
| 62 | Ga0072941_1013252 | 3300005201 | Bacteria | 14327 |
| 63 | Ga0072941_1091388 | 3300005201 | Bacteria | 2137 |
| 64 | Ga0123355_10467932 | 3300009826 | Bacteria | 1577 |
| 65 | Ga0123356_10134383 | 3300010049 | Bacteria | 2429 |
| 66 | Ga0123356_10354821 | 3300010049 | Bacteria | 1591 |
| 67 | Ga0123353_10429753 | 3300010167 | Bacteria | 1953 |
| 68 | Ga0123354_10236645 | 3300010882 | Bacteria | 1892 |
| 69 | Ga0466711_290279 | 3300042615 | Bacteria | 4617 |
| 70 | Ga0466711_424071 | 3300042615 | Bacteria | 2979 |
| 71 | Ga0466723_012334 | 3300042618 | Bacteria | 3541 |
| 72 | Ga0264413_119205 | 3300024493 | Bacteria | 16555 |
| 73 | Ga0415639_065171 | 3300038395 | Bacteria | 2449 |
| 74 | Ga0415639_065172 | 3300038395 | Bacteria | 5223 |
| 75 | Ga0466690_020891 | 3300042590 | Unclassified | 2046 |
| 76 | Ga0466690_104303 | 3300042590 | Bacteria | 2202 |
| 77 | Ga0466695_315985 | 3300042595 | Bacteria | 38906 |
| 78 | Ga0466699_128415 | 3300042597 | Bacteria | 2625 |
| 79 | Ga0466731_228191 | 3300042622 | Bacteria | 23388 |
| 80 | Ga0466704_105139 | 3300042643 | Bacteria | 1828 |
| 81 | Ga0466708_252730 | 3300042652 | Bacteria | 2383 |
| 82 | Ga0466713_117932 | 3300042602 | Bacteria | 2168 |
| 83 | Ga0466717_155026 | 3300042604 | Bacteria | 8803 |
| 84 | Ga0466716_285941 | 3300042605 | Bacteria | 13638 |
| 85 | Ga0466719_022784 | 3300042606 | Bacteria | 4650 |
| 86 | Ga0466722_106827 | 3300042609 | Bacteria | 2089 |
| 87 | Ga0466698_250769 | 3300042610 | Bacteria | 1841 |
| 88 | JGI24698J34947_10013286 | 3300002449 | Bacteria | 4497 |
| 89 | JGI24695J34938_10001733 | 3300002450 | Bacteria | 18026 |
| 90 | JGI24695J34938_10002397 | 3300002450 | Bacteria | 14404 |
| 91 | JGI24695J34938_10008017 | 3300002450 | Bacteria | 6090 |
| 92 | JGI24695J34938_10034588 | 3300002450 | Bacteria | 2318 |
| 93 | JGI24695J34938_10043167 | 3300002450 | Bacteria | 2013 |
| 94 | Ga0072941_1001452 | 3300005201 | Bacteria | 13621 |
| 95 | Ga0072941_1017427 | 3300005201 | Bacteria | 23253 |
| 96 | Ga0466732_287243 | 3300042656 | Bacteria | 2362 |
| 97 | Ga0562379_0561 | 3300056790 | Bacteria | 69205 |
| 98 | Ga0123356_10055722 | 3300010049 | Bacteria | 3683 |
| 99 | Ga0123353_10056177 | 3300010167 | Bacteria | 6300 |
| 100 | Ga0466711_071288 | 3300042615 | Bacteria | 27396 |
| 101 | Ga0466711_166346 | 3300042615 | Bacteria | 23077 |
| 102 | Ga0466723_078766 | 3300042618 | Bacteria | 5601 |
| 103 | Ga0466726_002369 | 3300042619 | Bacteria | 3517 |
| 104 | Ga0466728_022068 | 3300042620 | Bacteria | 6793 |
| 105 | Ga0466728_071575 | 3300042620 | Bacteria | 2577 |
| 106 | Ga0466728_292566 | 3300042620 | Bacteria | 4975 |
| 107 | Ga0264413_103890 | 3300024493 | Bacteria | 7028 |
| 108 | Ga0466690_102679 | 3300042590 | Bacteria | 7265 |
| 109 | Ga0466690_111689 | 3300042590 | Bacteria | 6688 |
| 110 | Ga0466692_189091 | 3300042591 | Bacteria | 5736 |
| 111 | Ga0466691_008848 | 3300042593 | Bacteria | 8230 |
| 112 | Ga0466691_029785 | 3300042593 | Bacteria | 3922 |
| 113 | Ga0466694_046100 | 3300042594 | Bacteria | 2241 |
| 114 | Ga0466694_049527 | 3300042594 | Bacteria | 2575 |
| 115 | Ga0466694_049866 | 3300042594 | Bacteria | 1550 |
| 116 | Ga0466694_151702 | 3300042594 | Bacteria | 12789 |
| 117 | Ga0466699_024380 | 3300042597 | Bacteria | 5987 |
| 118 | Ga0466699_408060 | 3300042597 | Bacteria | 1824 |
| 119 | Ga0466730_034370 | 3300042625 | Bacteria | 1392 |
| 120 | Ga0466700_169407 | 3300042600 | Bacteria | 2202 |
| 121 | Ga0466716_041770 | 3300042605 | Bacteria | 16148 |
| 122 | Ga0466716_195947 | 3300042605 | Bacteria | 29935 |
| 123 | Ga0466716_208786 | 3300042605 | Bacteria | 1618 |
| 124 | Ga0466716_255899 | 3300042605 | Bacteria | 2678 |
| 125 | Ga0466720_021934 | 3300042607 | Bacteria | 78212 |
| 126 | Ga0466720_044694 | 3300042607 | Bacteria | 11244 |
| 127 | Ga0466720_052591 | 3300042607 | Bacteria | 18158 |
| 128 | Ga0466722_011384 | 3300042609 | Bacteria | 2096 |
| 129 | JGI24698J34947_10000063 | 3300002449 | Bacteria | 33343 |
| 130 | JGI24698J34947_10002217 | 3300002449 | Bacteria | 10410 |
| 131 | JGI24695J34938_10025319 | 3300002450 | Bacteria | 2837 |
| 132 | Ga0072941_1151076 | 3300005201 | Bacteria | 1460 |
| 133 | Ga0562379_0009 | 3300056790 | Bacteria | 1927879 |
| 134 | Ga0123355_10065566 | 3300009826 | Bacteria | 5849 |
| 135 | Ga0123355_10141048 | 3300009826 | Bacteria | 3687 |
| 136 | Ga0123356_10000425 | 3300010049 | Bacteria | 48140 |
| 137 | Ga0123356_10000612 | 3300010049 | Bacteria | 39404 |
| 138 | Ga0123356_10011176 | 3300010049 | Bacteria | 8767 |
| 139 | Ga0123356_10013620 | 3300010049 | Bacteria | 7839 |
| 140 | Ga0123356_10062835 | 3300010049 | Bacteria | 3469 |
| 141 | Ga0123356_10113451 | 3300010049 | Bacteria | 2622 |
| 142 | Ga0466705_399855 | 3300042612 | Unclassified | 5369 |
| 143 | Ga0466712_048742 | 3300042614 | Bacteria | 29753 |
| 144 | Ga0466723_032543 | 3300042618 | Bacteria | 4695 |
| 145 | Ga0466723_229132 | 3300042618 | Bacteria | 4148 |
| 146 | Ga0466723_282391 | 3300042618 | Bacteria | 2766 |
| 147 | Ga0466726_018493 | 3300042619 | Bacteria | 4612 |
| 148 | Ga0466728_120396 | 3300042620 | Bacteria | 8998 |
| 149 | Ga0415639_020741 | 3300038395 | Bacteria | 8437 |
| 150 | Ga0466693_338101 | 3300042592 | Bacteria | 1801 |
| 151 | Ga0466696_137087 | 3300042596 | Bacteria | 42498 |
| 152 | Ga0466699_163700 | 3300042597 | Bacteria | 58200 |
| 153 | Ga0466704_057747 | 3300042643 | Bacteria | 4663 |
| 154 | Ga0466704_531072 | 3300042643 | Bacteria | 4410 |
| 155 | Ga0466708_289566 | 3300042652 | Bacteria | 3477 |
| 156 | Ga0466706_097109 | 3300042599 | Bacteria | 1305 |
| 157 | Ga0466716_083955 | 3300042605 | Bacteria | 5408 |
| 158 | Ga0466720_006685 | 3300042607 | Bacteria | 20490 |
| 159 | Ga0466720_158733 | 3300042607 | Bacteria | 2630 |
| 160 | Ga0466722_103405 | 3300042609 | Bacteria | 12737 |
| 161 | Ga0466698_061711 | 3300042610 | Bacteria | 1522 |
| 162 | Ga0466705_376652 | 3300042612 | Bacteria | 13056 |
| 163 | JGI24698J34947_10089113 | 3300002449 | Bacteria | 1421 |
| 164 | JGI24695J34938_10042716 | 3300002450 | Bacteria | 2026 |
| 165 | JGI24696J40584_12944474 | 3300002834 | Bacteria | 1814 |
| 166 | Ga0562378_0064 | 3300056814 | Unclassified | 307537 |
| 167 | Ga0123356_10145813 | 3300010049 | Bacteria | 2342 |
| 168 | Ga0466711_038973 | 3300042615 | Bacteria | 29172 |
| 169 | Ga0466711_132252 | 3300042615 | Bacteria | 3430 |
| 170 | Ga0466715_009722 | 3300042616 | Bacteria | 3591 |
| 171 | Ga0466718_017419 | 3300042617 | Bacteria | 1888 |
| 172 | Ga0466718_026154 | 3300042617 | Bacteria | 9306 |
| 173 | Ga0160447_102367 | 3300012849 | Bacteria | 6651 |
| 174 | Ga0264413_121137 | 3300024493 | Bacteria | 1678 |
| 175 | Ga0466690_111467 | 3300042590 | Unclassified | 1373 |
| 176 | Ga0466694_106364 | 3300042594 | Bacteria | 28135 |
| 177 | Ga0466694_183897 | 3300042594 | Bacteria | 50196 |
| 178 | Ga0466696_272411 | 3300042596 | Bacteria | 4594 |
| 179 | Ga0466730_025583 | 3300042625 | Bacteria | 5595 |
| 180 | Ga0466702_370819 | 3300042635 | Bacteria | 13283 |
| 181 | Ga0466709_418164 | 3300042648 | Bacteria | 8521 |
| 182 | Ga0466708_020221 | 3300042652 | Bacteria | 5490 |
| 183 | Ga0466708_229306 | 3300042652 | Bacteria | 3966 |
| 184 | Ga0466701_035819 | 3300042598 | Bacteria | 64768 |
| 185 | Ga0466713_022474 | 3300042602 | Bacteria | 71754 |
| 186 | Ga0466722_040130 | 3300042609 | Bacteria | 1927 |
| 187 | Ga0466722_044046 | 3300042609 | Bacteria | 3784 |
| 188 | AustNasuHG_c1037985 | 3300000089 | Bacteria | 1220 |
| 189 | JGI24698J34947_10036617 | 3300002449 | Bacteria | 2554 |
| 190 | JGI24698J34947_10076257 | 3300002449 | Bacteria | 1590 |
| 191 | JGI24695J34938_10000035 | 3300002450 | Bacteria | 102136 |
| 192 | JGI24695J34938_10000239 | 3300002450 | Bacteria | 52549 |
| 193 | JGI24695J34938_10000271 | 3300002450 | Bacteria | 50591 |
| 194 | Ga0466732_241019 | 3300042656 | Bacteria | 2915 |
| 195 | Ga0466733_184370 | 3300042659 | Bacteria | 9974 |
| 196 | Ga0562374_0011 | 3300057007 | Bacteria | 1900075 |
| 197 | Ga0123356_10004605 | 3300010049 | Bacteria | 14210 |
| 198 | Ga0123356_10083859 | 3300010049 | Bacteria | 3020 |
| 199 | Ga0123356_10274399 | 3300010049 | Bacteria | 1778 |
| 200 | Ga0123353_10315715 | 3300010167 | Bacteria | 2375 |
| 201 | Ga0466712_175596 | 3300042614 | Bacteria | 11197 |
| 202 | Ga0466711_390004 | 3300042615 | Bacteria | 20738 |
| 203 | Ga0466723_018886 | 3300042618 | Bacteria | 1912 |
| 204 | Ga0466723_075517 | 3300042618 | Bacteria | 4000 |
| 205 | Ga0264413_119148 | 3300024493 | Bacteria | 9115 |
| 206 | Ga0264413_119203 | 3300024493 | Bacteria | 1154 |
| 207 | Ga0415639_001687 | 3300038395 | Bacteria | 13238 |
| 208 | Ga0415639_065122 | 3300038395 | Bacteria | 2188 |
| 209 | Ga0466690_270545 | 3300042590 | Bacteria | 2846 |
| 210 | Ga0466699_190328 | 3300042597 | Bacteria | 1330 |
| 211 | Ga0466699_206105 | 3300042597 | Bacteria | 17521 |
| 212 | Ga0466699_300555 | 3300042597 | Bacteria | 3038 |
| 213 | Ga0466699_399913 | 3300042597 | Bacteria | 6883 |
| 214 | Ga0466734_157753 | 3300042623 | Bacteria | 1132 |
| 215 | Ga0466735_169251 | 3300042624 | Bacteria | 3237 |
| 216 | Ga0466703_155754 | 3300042636 | Bacteria | 2573 |
| 217 | Ga0466704_109252 | 3300042643 | Bacteria | 9627 |
| 218 | Ga0466709_221241 | 3300042648 | Bacteria | 4013 |
| 219 | Ga0466708_084959 | 3300042652 | Bacteria | 2761 |
| 220 | Ga0466727_121080 | 3300042655 | Bacteria | 2705 |
| 221 | Ga0466707_165142 | 3300042601 | Bacteria | 1174 |
| 222 | Ga0466713_115149 | 3300042602 | Bacteria | 112353 |
| 223 | Ga0466717_010331 | 3300042604 | Bacteria | 4632 |
| 224 | Ga0466719_245367 | 3300042606 | Bacteria | 5030 |
| 225 | Ga0466719_263477 | 3300042606 | Bacteria | 7510 |
| 226 | Ga0466720_067355 | 3300042607 | Bacteria | 19475 |
| 227 | Ga0466722_042898 | 3300042609 | Bacteria | 3614 |
| 228 | Ga0466722_121644 | 3300042609 | Bacteria | 3319 |
| 229 | Ga0466722_132546 | 3300042609 | Bacteria | 27700 |
| 230 | Ga0466698_418353 | 3300042610 | Bacteria | 1895 |
| 231 | Ga0466705_214206 | 3300042612 | Bacteria | 10142 |
| 232 | AustNasuHG_c1019829 | 3300000089 | Unclassified | 2200 |
| 233 | JGI24698J34947_10004352 | 3300002449 | Bacteria | 7705 |
| 234 | JGI24698J34947_10009580 | 3300002449 | Bacteria | 5311 |
| 235 | JGI24695J34938_10000008 | 3300002450 | Bacteria | 136681 |
| 236 | JGI24695J34938_10001031 | 3300002450 | Bacteria | 25228 |
| 237 | Ga0123356_10040445 | 3300010049 | Bacteria | 4344 |
| 238 | Ga0123356_10359858 | 3300010049 | Bacteria | 1582 |
| 239 | Ga0466712_231274 | 3300042614 | Bacteria | 8762 |
| 240 | Ga0466711_148287 | 3300042615 | Bacteria | 5104 |
| 241 | Ga0466728_097728 | 3300042620 | Bacteria | 5086 |
| 242 | Ga0264413_102199 | 3300024493 | Bacteria | 8139 |
| 243 | Ga0466690_092347 | 3300042590 | Bacteria | 4735 |
| 244 | Ga0466690_293011 | 3300042590 | Bacteria | 2780 |
| 245 | Ga0466692_041240 | 3300042591 | Bacteria | 16788 |
| 246 | Ga0466692_104364 | 3300042591 | Bacteria | 24959 |
| 247 | Ga0466693_135525 | 3300042592 | Bacteria | 26238 |
| 248 | Ga0466691_065097 | 3300042593 | Bacteria | 3738 |
| 249 | Ga0466694_246809 | 3300042594 | Bacteria | 2670 |
| 250 | Ga0466694_250607 | 3300042594 | Bacteria | 20568 |
| 251 | Ga0466694_315883 | 3300042594 | Bacteria | 2945 |
| 252 | Ga0466699_082416 | 3300042597 | Bacteria | 11145 |
| 253 | Ga0466699_433815 | 3300042597 | Bacteria | 3374 |
| 254 | Ga0466729_255230 | 3300042621 | Bacteria | 2369 |
| 255 | Ga0466729_293513 | 3300042621 | Bacteria | 1961 |
| 256 | Ga0466731_317125 | 3300042622 | Bacteria | 1729 |
| 257 | Ga0466731_352856 | 3300042622 | Unclassified | 2402 |
| 258 | Ga0466703_023009 | 3300042636 | Bacteria | 50399 |
| 259 | Ga0466704_111749 | 3300042643 | Bacteria | 5003 |
| 260 | Ga0466704_385063 | 3300042643 | Bacteria | 30536 |
| 261 | Ga0466707_288103 | 3300042601 | Bacteria | 5373 |
| 262 | Ga0466716_049981 | 3300042605 | Bacteria | 12269 |
| 263 | Ga0466719_099273 | 3300042606 | Bacteria | 5344 |
| 264 | Ga0466720_147033 | 3300042607 | Bacteria | 48792 |
| 265 | Ga0466722_125680 | 3300042609 | Bacteria | 2307 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF09084 | NMT1 | NMT1/THI5 like | 81 | 297 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.