Protein Family IF05257
Metagenome
Isolate
183
Members
71
Samples
170
Scaffolds
317.07
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_495929|Ga0466696_495929_1440_2699
- Length
- 372 aa
- Sequence
- MDISIVVPVYNEEESLKELTIWISKVMKYYRYAYEIIMVDDGSVDNSWNVISGISQKNSNVKGVSFRRNYGKSAALQKGFELASGEVVITMDADLQDSPDEIPELYKMIKYDGYDMVSGWKKKRHDPIHKRWPSKFYNKTVRAFSGIKLHDFNCGLKAYRKDVVKSIEVYGEMHRYIPVIAKWAGFKNIGEKVVNHHARKFGKSKFGMERYFKGYLDLLTISFISRYGRRPMHFFGLIGTLLFLAGFIIAIYLAYQKIANQVYYMTTRPLFYFGLLAMGGFLGELISRNGSDRNRYHLKNNIGFSKSDAMITTNTTLPKERIIIEKTASTSKQKATPIKDKKPAKKAEIELPKNELQEKTVKKGSDANKINE
Sample Types
Isolate
7.1%
Metagenome
92.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.5%
Kalotermitidae
22.2%
Unclassified
9.5%
Drosophilidae
6.3%
Armadillidiidae
6.3%
Culicidae
6.3%
Passalidae
3.2%
Termopsidae
3.2%
Rhinotermitidae
1.6%
Bombycidae
1.6%
Hodotermitidae
1.6%
Hydrophilidae
1.6%
Taxonomy
Archaea
0
Bacteria
177
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 2 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 3 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 4 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 5 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 6 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 7 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 8 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 9 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 10 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 14 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 19 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 20 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 21 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 22 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 23 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 24 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 25 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 26 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 27 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 32 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 33 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 34 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 35 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 39 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 40 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 41 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 42 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 43 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 44 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 45 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 46 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 47 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 48 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 49 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 50 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 51 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 52 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 53 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 54 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 55 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 56 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 57 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 58 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 59 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 60 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 61 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 62 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 63 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 64 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 65 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 66 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 67 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 68 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 69 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 70 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 71 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_106937 | 3300042612 | Bacteria | 16700 |
| 2 | Ga0466714_150592 | 3300042603 | Bacteria | 1998 |
| 3 | Ga0466719_443035 | 3300042606 | Bacteria | 1757 |
| 4 | Ga0466722_210533 | 3300042609 | Bacteria | 7884 |
| 5 | Ga0104045_1004469 | 3300007085 | Bacteria | 12175 |
| 6 | Ga0104045_1022983 | 3300007085 | Unclassified | 2528 |
| 7 | Ga0104045_1076268 | 3300007085 | Bacteria | 1713 |
| 8 | Ga0104048_1024748 | 3300007143 | Bacteria | 5907 |
| 9 | Ga0466710_105098 | 3300042613 | Bacteria | 1624 |
| 10 | Ga0466715_221281 | 3300042616 | Bacteria | 18002 |
| 11 | Ga0466723_019179 | 3300042618 | Bacteria | 6986 |
| 12 | Ga0466723_115474 | 3300042618 | Bacteria | 11407 |
| 13 | Ga0466723_196550 | 3300042618 | Bacteria | 18798 |
| 14 | Ga0466726_256112 | 3300042619 | Bacteria | 1688 |
| 15 | Ga0123357_10252545 | 3300009784 | Bacteria | 1883 |
| 16 | Ga0466731_160395 | 3300042622 | Bacteria | 3828 |
| 17 | Ga0466731_360708 | 3300042622 | Bacteria | 6479 |
| 18 | Ga0466724_27765 | 3300042649 | Bacteria | 3727 |
| 19 | Ga0466724_36289 | 3300042649 | Bacteria | 18655 |
| 20 | Ga0466708_147506 | 3300042652 | Bacteria | 8066 |
| 21 | Ga0466708_422142 | 3300042652 | Bacteria | 2570 |
| 22 | Ga0160472_100054 | 3300012839 | Bacteria | 185362 |
| 23 | Ga0466693_369443 | 3300042592 | Bacteria | 5794 |
| 24 | Ga0466691_188239 | 3300042593 | Bacteria | 6364 |
| 25 | Ga0466694_142525 | 3300042594 | Bacteria | 1109 |
| 26 | Ga0466695_077574 | 3300042595 | Bacteria | 1217 |
| 27 | Ga0466696_075547 | 3300042596 | Bacteria | 9309 |
| 28 | Ga0466696_495929 | 3300042596 | Bacteria | 15308 |
| 29 | Ga0466733_012964 | 3300042659 | Bacteria | 37267 |
| 30 | Ga0466706_021806 | 3300042599 | Bacteria | 11800 |
| 31 | Ga0466716_322882 | 3300042605 | Bacteria | 1566 |
| 32 | Ga0466719_344560 | 3300042606 | Bacteria | 3635 |
| 33 | JGI24702J35022_10001488 | 3300002462 | Bacteria | 14544 |
| 34 | JGI24702J35022_10021409 | 3300002462 | Bacteria | 3507 |
| 35 | Ga0072941_1206338 | 3300005201 | Bacteria | 2525 |
| 36 | Ga0104050_1009799 | 3300007153 | Bacteria | 2887 |
| 37 | Ga0466710_148645 | 3300042613 | Bacteria | 1846 |
| 38 | Ga0466710_458716 | 3300042613 | Bacteria | 1834 |
| 39 | Ga0466723_007363 | 3300042618 | Bacteria | 16093 |
| 40 | Ga0466726_110660 | 3300042619 | Bacteria | 5497 |
| 41 | Ga0466728_199788 | 3300042620 | Bacteria | 2958 |
| 42 | Ga0123355_10462727 | 3300009826 | Bacteria | 1590 |
| 43 | Ga0123354_10009285 | 3300010882 | Bacteria | 15043 |
| 44 | Ga0123354_10397505 | 3300010882 | Bacteria | 1171 |
| 45 | Ga0466731_385961 | 3300042622 | Bacteria | 2842 |
| 46 | Ga0466734_093544 | 3300042623 | Bacteria | 2464 |
| 47 | Ga0466703_250283 | 3300042636 | Bacteria | 8787 |
| 48 | Ga0466724_20088 | 3300042649 | Bacteria | 4406 |
| 49 | Ga0466724_39659 | 3300042649 | Unclassified | 8930 |
| 50 | Ga0466724_62265 | 3300042649 | Bacteria | 8930 |
| 51 | Ga0466708_206183 | 3300042652 | Bacteria | 28300 |
| 52 | Ga0160453_100001 | 3300012814 | Bacteria | 1272344 |
| 53 | Ga0160469_100004 | 3300012824 | Bacteria | 821419 |
| 54 | Ga0466690_193243 | 3300042590 | Bacteria | 3826 |
| 55 | Ga0466691_016036 | 3300042593 | Unclassified | 9794 |
| 56 | Ga0466691_137298 | 3300042593 | Bacteria | 5724 |
| 57 | Ga0466732_113503 | 3300042656 | Bacteria | 2027 |
| 58 | Ga0466701_054707 | 3300042598 | Bacteria | 2475 |
| 59 | Ga0466714_074208 | 3300042603 | Bacteria | 2154 |
| 60 | Ga0466714_155108 | 3300042603 | Bacteria | 1742 |
| 61 | Ga0466716_109406 | 3300042605 | Bacteria | 1502 |
| 62 | Ga0466716_399087 | 3300042605 | Bacteria | 4204 |
| 63 | Ga0466719_363227 | 3300042606 | Bacteria | 5799 |
| 64 | JGI24696J40584_12949811 | 3300002834 | Bacteria | 2102 |
| 65 | Ga0104045_1075519 | 3300007085 | Bacteria | 1936 |
| 66 | Ga0466711_075341 | 3300042615 | Bacteria | 8692 |
| 67 | Ga0466723_066635 | 3300042618 | Bacteria | 8230 |
| 68 | Ga0466723_283671 | 3300042618 | Bacteria | 34853 |
| 69 | Ga0466726_228566 | 3300042619 | Bacteria | 4019 |
| 70 | Ga0466728_187106 | 3300042620 | Bacteria | 3819 |
| 71 | Ga0466728_474971 | 3300042620 | Bacteria | 7961 |
| 72 | Ga0160466_100012 | 3300012809 | Bacteria | 390121 |
| 73 | Ga0160470_100001 | 3300012813 | Bacteria | 1272206 |
| 74 | Ga0466731_202073 | 3300042622 | Bacteria | 2252 |
| 75 | Ga0466703_165189 | 3300042636 | Bacteria | 7217 |
| 76 | Ga0160445_100135 | 3300012847 | Bacteria | 64427 |
| 77 | Ga0160436_1003765 | 3300012861 | Bacteria | 3682 |
| 78 | Ga0466690_083281 | 3300042590 | Bacteria | 17372 |
| 79 | Ga0466690_219853 | 3300042590 | Bacteria | 5714 |
| 80 | Ga0466733_036442 | 3300042659 | Bacteria | 4939 |
| 81 | 2227517985 | 2225789004 | Bacteria | 3397 |
| 82 | JGI24696J40584_12942502 | 3300002834 | Bacteria | 1743 |
| 83 | Ga0466715_287839 | 3300042616 | Bacteria | 30667 |
| 84 | Ga0466728_141273 | 3300042620 | Bacteria | 7423 |
| 85 | Ga0123356_10014048 | 3300010049 | Bacteria | 7703 |
| 86 | Ga0123354_10056953 | 3300010882 | Bacteria | 5829 |
| 87 | Ga0466735_090521 | 3300042624 | Bacteria | 1839 |
| 88 | Ga0466709_225343 | 3300042648 | Bacteria | 12952 |
| 89 | Ga0466724_35467 | 3300042649 | Bacteria | 3816 |
| 90 | Ga0466708_126215 | 3300042652 | Bacteria | 3093 |
| 91 | Ga0466705_323785 | 3300042612 | Bacteria | 10850 |
| 92 | Ga0466705_359318 | 3300042612 | Bacteria | 4684 |
| 93 | Ga0466733_026941 | 3300042659 | Bacteria | 8673 |
| 94 | Ga0466706_073754 | 3300042599 | Bacteria | 6313 |
| 95 | JGI24705J35276_12226676 | 3300002504 | Bacteria | 2890 |
| 96 | Ga0074308_1117067 | 3300005307 | Bacteria | 1056 |
| 97 | Ga0466710_232518 | 3300042613 | Bacteria | 2120 |
| 98 | Ga0466715_052065 | 3300042616 | Bacteria | 25727 |
| 99 | Ga0466723_270766 | 3300042618 | Bacteria | 18832 |
| 100 | Ga0123353_10068914 | 3300010167 | Bacteria | 5681 |
| 101 | Ga0123353_10120456 | 3300010167 | Bacteria | 4219 |
| 102 | Ga0123353_10299088 | 3300010167 | Bacteria | 2458 |
| 103 | Ga0123353_10351776 | 3300010167 | Unclassified | 2219 |
| 104 | Ga0123354_10076740 | 3300010882 | Bacteria | 4766 |
| 105 | Ga0466724_23664 | 3300042649 | Bacteria | 3767 |
| 106 | Ga0466690_366072 | 3300042590 | Bacteria | 4072 |
| 107 | Ga0466694_019064 | 3300042594 | Bacteria | 1753 |
| 108 | Ga0466696_106901 | 3300042596 | Bacteria | 16358 |
| 109 | Ga0466696_143786 | 3300042596 | Bacteria | 27943 |
| 110 | Ga0466696_446157 | 3300042596 | Bacteria | 4583 |
| 111 | Ga0466701_021309 | 3300042598 | Bacteria | 13403 |
| 112 | Ga0466701_075777 | 3300042598 | Bacteria | 2989 |
| 113 | Ga0466706_015916 | 3300042599 | Bacteria | 2611 |
| 114 | Ga0466722_160223 | 3300042609 | Bacteria | 15399 |
| 115 | JGI24702J35022_10001651 | 3300002462 | Bacteria | 13859 |
| 116 | Ga0466710_192829 | 3300042613 | Bacteria | 1480 |
| 117 | Ga0466710_432372 | 3300042613 | Bacteria | 2106 |
| 118 | Ga0466715_113386 | 3300042616 | Bacteria | 2308 |
| 119 | Ga0466728_022802 | 3300042620 | Bacteria | 8502 |
| 120 | Ga0123356_10002911 | 3300010049 | Bacteria | 18129 |
| 121 | Ga0123353_10080363 | 3300010167 | Bacteria | 5243 |
| 122 | Ga0466730_039992 | 3300042625 | Bacteria | 1355215 |
| 123 | Ga0466703_194003 | 3300042636 | Bacteria | 5471 |
| 124 | Ga0466704_596017 | 3300042643 | Bacteria | 2954 |
| 125 | Ga0160472_101765 | 3300012839 | Bacteria | 5657 |
| 126 | Ga0466696_345172 | 3300042596 | Bacteria | 2009 |
| 127 | Ga0466699_239853 | 3300042597 | Bacteria | 2405 |
| 128 | Ga0466733_114625 | 3300042659 | Bacteria | 12447 |
| 129 | Ga0466701_033731 | 3300042598 | Bacteria | 5522 |
| 130 | Ga0466713_025848 | 3300042602 | Bacteria | 19465 |
| 131 | Ga0466713_119808 | 3300042602 | Bacteria | 48294 |
| 132 | Ga0466716_213216 | 3300042605 | Bacteria | 4155 |
| 133 | Ga0466716_270697 | 3300042605 | Bacteria | 3704 |
| 134 | Ga0466720_137061 | 3300042607 | Bacteria | 2919 |
| 135 | Ga0466722_182464 | 3300042609 | Bacteria | 2540 |
| 136 | Ga0466722_188725 | 3300042609 | Bacteria | 6202 |
| 137 | Ga0466698_329469 | 3300042610 | Bacteria | 1832 |
| 138 | JGI24702J35022_10186640 | 3300002462 | Bacteria | 1181 |
| 139 | Ga0104050_1033150 | 3300007153 | Unclassified | 7414 |
| 140 | Ga0466711_041320 | 3300042615 | Bacteria | 4259 |
| 141 | Ga0123357_10101672 | 3300009784 | Bacteria | 3703 |
| 142 | Ga0123356_10029182 | 3300010049 | Bacteria | 5168 |
| 143 | Ga0123353_10140527 | 3300010167 | Bacteria | 3869 |
| 144 | Ga0123353_10200220 | 3300010167 | Bacteria | 3142 |
| 145 | Ga0466703_050239 | 3300042636 | Bacteria | 5585 |
| 146 | Ga0466709_198532 | 3300042648 | Bacteria | 44178 |
| 147 | Ga0466708_220766 | 3300042652 | Bacteria | 3388 |
| 148 | Ga0160445_105138 | 3300012847 | Bacteria | 2271 |
| 149 | Ga0160443_104338 | 3300012848 | Unclassified | 2156 |
| 150 | Ga0466691_107220 | 3300042593 | Bacteria | 9135 |
| 151 | Ga0466732_384183 | 3300042656 | Bacteria | 1838 |
| 152 | Ga0466701_099198 | 3300042598 | Bacteria | 111054 |
| 153 | Ga0466701_100714 | 3300042598 | Bacteria | 26015 |
| 154 | Ga0466722_010442 | 3300042609 | Bacteria | 16245 |
| 155 | IMNBL1DRAFT_c0003642 | 3300000062 | Bacteria | 9727 |
| 156 | JGI24702J35022_10007269 | 3300002462 | Bacteria | 6357 |
| 157 | Ga0104045_1001163 | 3300007085 | Bacteria | 14264 |
| 158 | Ga0104048_1001150 | 3300007143 | Bacteria | 4319 |
| 159 | Ga0466710_454591 | 3300042613 | Bacteria | 3790 |
| 160 | Ga0466728_349493 | 3300042620 | Bacteria | 4604 |
| 161 | Ga0123353_10092686 | 3300010167 | Bacteria | 4867 |
| 162 | Ga0123353_10131312 | 3300010167 | Bacteria | 4018 |
| 163 | Ga0123353_10557453 | 3300010167 | Bacteria | 1651 |
| 164 | Ga0466708_039466 | 3300042652 | Bacteria | 5604 |
| 165 | Ga0466708_088711 | 3300042652 | Bacteria | 35515 |
| 166 | Ga0160444_100121 | 3300012841 | Bacteria | 83005 |
| 167 | Ga0160447_100018 | 3300012849 | Bacteria | 260737 |
| 168 | Ga0466690_077666 | 3300042590 | Bacteria | 3595 |
| 169 | Ga0466690_089615 | 3300042590 | Bacteria | 17631 |
| 170 | Ga0466690_104073 | 3300042590 | Bacteria | 10792 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.