Protein Family IF05252
Metagenome
Isolate
149
Members
61
Samples
129
Scaffolds
253.5
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_460040|Ga0466696_460040_1039_1848
- Length
- 269 aa
- Sequence
- MRLDSFVNFKILEDMELTDIIKPDNLVYGKPELMNNNPMHYCPGCSHGVIHKLIAEVIADMGMEEQTVGVSPVGCAVFAYNYLDIDWVEAAHGRAPAVATALKRLNRDKMVFTYQGDGDLAAIGTAETIHAANRGENIVIVFVNNAIYGMTGGQMAPTTLEGMPTSTCPYGRDVELNGYPLKISDLLAALEGTCYVTRQSVHTASAVRKAKKSLRKAFENSMTTGKGTSVVEFVSTCSSGWKMTPGRANTWMEEHMFPFYPLGDIKNVE
Sample Types
Isolate
13.4%
Metagenome
86.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
32.2%
Termitidae
23.7%
Kalotermitidae
23.7%
Unclassified
6.8%
Rhinotermitidae
5.1%
Termopsidae
3.4%
Passalidae
3.4%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
143
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 2 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 3 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 4 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 14 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 17 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 20 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 25 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 26 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 27 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 28 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 29 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 30 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 31 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 32 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 33 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 34 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 35 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 36 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 37 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 38 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 39 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 40 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 41 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 47 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 48 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 49 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 50 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 51 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 52 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 53 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 54 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 55 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 56 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 57 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 58 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 59 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 60 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 61 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466696_141833 | 3300042596 | Bacteria | 18307 |
| 2 | Ga0466696_168764 | 3300042596 | Bacteria | 12119 |
| 3 | Ga0466711_123903 | 3300042615 | Bacteria | 10875 |
| 4 | Ga0466711_288717 | 3300042615 | Bacteria | 5493 |
| 5 | Ga0466715_184077 | 3300042616 | Bacteria | 7041 |
| 6 | Ga0466715_323248 | 3300042616 | Bacteria | 7339 |
| 7 | Ga0466728_011534 | 3300042620 | Bacteria | 28821 |
| 8 | Ga0466729_304089 | 3300042621 | Bacteria | 3988 |
| 9 | Ga0466734_060110 | 3300042623 | Bacteria | 1901 |
| 10 | Ga0466707_010317 | 3300042601 | Bacteria | 15926 |
| 11 | Ga0466719_433192 | 3300042606 | Bacteria | 5396 |
| 12 | JGI24702J35022_10000131 | 3300002462 | Bacteria | 37210 |
| 13 | JGI24699J35502_11134162 | 3300002509 | Bacteria | 41397 |
| 14 | Ga0072941_1187421 | 3300005201 | Bacteria | 3125 |
| 15 | Ga0466692_166187 | 3300042591 | Bacteria | 20656 |
| 16 | Ga0466711_042337 | 3300042615 | Bacteria | 11612 |
| 17 | Ga0466726_425750 | 3300042619 | Bacteria | 5812 |
| 18 | Ga0466703_212954 | 3300042636 | Bacteria | 10233 |
| 19 | Ga0466704_176646 | 3300042643 | Bacteria | 62821 |
| 20 | Ga0466704_353772 | 3300042643 | Bacteria | 9855 |
| 21 | Ga0466708_011017 | 3300042652 | Bacteria | 14569 |
| 22 | Ga0466708_023581 | 3300042652 | Bacteria | 13912 |
| 23 | Ga0466700_392445 | 3300042600 | Bacteria | 26880 |
| 24 | 2227477119 | 2225789004 | Bacteria | 4600 |
| 25 | JGI24702J35022_10138932 | 3300002462 | Bacteria | 1354 |
| 26 | JGI24702J35022_10232793 | 3300002462 | Unclassified | 1066 |
| 27 | Ga0072941_1121775 | 3300005201 | Bacteria | 4303 |
| 28 | Ga0466705_304422 | 3300042612 | Unclassified | 1291 |
| 29 | Ga0466733_125743 | 3300042659 | Bacteria | 5829 |
| 30 | Ga0466690_096620 | 3300042590 | Bacteria | 3835 |
| 31 | Ga0466691_031003 | 3300042593 | Bacteria | 14168 |
| 32 | Ga0123354_10000735 | 3300010882 | Bacteria | 35280 |
| 33 | Ga0466726_289930 | 3300042619 | Bacteria | 8500 |
| 34 | Ga0466728_180564 | 3300042620 | Bacteria | 92308 |
| 35 | Ga0466704_472879 | 3300042643 | Bacteria | 13574 |
| 36 | Ga0466727_076192 | 3300042655 | Bacteria | 4594 |
| 37 | Ga0466707_047433 | 3300042601 | Bacteria | 3983 |
| 38 | Ga0466707_337488 | 3300042601 | Bacteria | 18461 |
| 39 | Ga0466713_021134 | 3300042602 | Bacteria | 7003 |
| 40 | Ga0466716_084851 | 3300042605 | Bacteria | 10801 |
| 41 | Ga0466719_243196 | 3300042606 | Bacteria | 2664 |
| 42 | Ga0466698_492792 | 3300042610 | Unclassified | 2289 |
| 43 | 2227610723 | 2225789004 | Bacteria | 12124 |
| 44 | IMNBL1DRAFT_c0001129 | 3300000062 | Bacteria | 20460 |
| 45 | JGI24702J35022_10009097 | 3300002462 | Bacteria | 5593 |
| 46 | Ga0466705_068471 | 3300042612 | Bacteria | 9310 |
| 47 | Ga0466705_091070 | 3300042612 | Bacteria | 9169 |
| 48 | Ga0466705_269867 | 3300042612 | Bacteria | 9669 |
| 49 | Ga0265387_1008790 | 3300024582 | Unclassified | 1360 |
| 50 | Ga0466690_253817 | 3300042590 | Bacteria | 10765 |
| 51 | Ga0466696_085036 | 3300042596 | Bacteria | 6487 |
| 52 | Ga0466711_080977 | 3300042615 | Bacteria | 6892 |
| 53 | Ga0466715_621995 | 3300042616 | Bacteria | 20259 |
| 54 | Ga0466728_288205 | 3300042620 | Bacteria | 17761 |
| 55 | Ga0466729_130708 | 3300042621 | Bacteria | 3609 |
| 56 | Ga0466703_138188 | 3300042636 | Bacteria | 2511 |
| 57 | Ga0466703_170324 | 3300042636 | Bacteria | 10917 |
| 58 | Ga0466704_067267 | 3300042643 | Bacteria | 9780 |
| 59 | Ga0466709_275349 | 3300042648 | Unclassified | 4986 |
| 60 | Ga0466727_090010 | 3300042655 | Bacteria | 8453 |
| 61 | Ga0466727_120961 | 3300042655 | Bacteria | 5719 |
| 62 | Ga0466706_016347 | 3300042599 | Bacteria | 3942 |
| 63 | Ga0466713_020992 | 3300042602 | Bacteria | 62959 |
| 64 | Ga0466714_101114 | 3300042603 | Bacteria | 64102 |
| 65 | 2227485761 | 2225789004 | Bacteria | 21098 |
| 66 | JGI24705J35276_12191825 | 3300002504 | Bacteria | 1479 |
| 67 | Ga0466690_213523 | 3300042590 | Bacteria | 18139 |
| 68 | Ga0466692_001194 | 3300042591 | Bacteria | 22639 |
| 69 | Ga0466691_029267 | 3300042593 | Bacteria | 26342 |
| 70 | Ga0466711_286714 | 3300042615 | Bacteria | 23462 |
| 71 | Ga0466715_255387 | 3300042616 | Bacteria | 2893 |
| 72 | Ga0466715_429111 | 3300042616 | Bacteria | 6362 |
| 73 | Ga0466723_095121 | 3300042618 | Bacteria | 177949 |
| 74 | Ga0466723_136332 | 3300042618 | Bacteria | 15291 |
| 75 | Ga0466723_182664 | 3300042618 | Bacteria | 13551 |
| 76 | Ga0466703_046877 | 3300042636 | Bacteria | 5027 |
| 77 | Ga0466703_048877 | 3300042636 | Bacteria | 2674 |
| 78 | Ga0466704_055202 | 3300042643 | Bacteria | 5738 |
| 79 | Ga0466704_057568 | 3300042643 | Bacteria | 3271 |
| 80 | Ga0466704_162945 | 3300042643 | Bacteria | 4788 |
| 81 | Ga0466709_237932 | 3300042648 | Bacteria | 7852 |
| 82 | Ga0466727_170229 | 3300042655 | Bacteria | 6312 |
| 83 | Ga0466714_082006 | 3300042603 | Bacteria | 191145 |
| 84 | Ga0466719_377300 | 3300042606 | Bacteria | 1895 |
| 85 | IMNBL1DRAFT_c0000274 | 3300000062 | Bacteria | 45532 |
| 86 | JGI24702J35022_10032806 | 3300002462 | Bacteria | 2779 |
| 87 | JGI24699J35502_11133334 | 3300002509 | Bacteria | 9904 |
| 88 | Ga0068305_10072625 | 3300005083 | Unclassified | 13914 |
| 89 | Ga0466705_152618 | 3300042612 | Bacteria | 16804 |
| 90 | Ga0466733_029904 | 3300042659 | Bacteria | 2239 |
| 91 | Ga0466690_419789 | 3300042590 | Bacteria | 20681 |
| 92 | Ga0466696_054052 | 3300042596 | Bacteria | 3711 |
| 93 | Ga0466696_248480 | 3300042596 | Bacteria | 8299 |
| 94 | Ga0466711_021252 | 3300042615 | Bacteria | 8622 |
| 95 | Ga0466731_424101 | 3300042622 | Bacteria | 3436 |
| 96 | Ga0466704_044961 | 3300042643 | Bacteria | 2873 |
| 97 | Ga0466707_414711 | 3300042601 | Bacteria | 12149 |
| 98 | Ga0466716_068984 | 3300042605 | Bacteria | 6876 |
| 99 | Ga0466719_206576 | 3300042606 | Bacteria | 9122 |
| 100 | Ga0466722_166869 | 3300042609 | Bacteria | 6947 |
| 101 | Ga0466690_063861 | 3300042590 | Bacteria | 11353 |
| 102 | Ga0466690_258904 | 3300042590 | Bacteria | 4664 |
| 103 | Ga0466692_121070 | 3300042591 | Bacteria | 8911 |
| 104 | Ga0466691_103420 | 3300042593 | Bacteria | 10591 |
| 105 | Ga0466696_105777 | 3300042596 | Bacteria | 41166 |
| 106 | Ga0123353_10053440 | 3300010167 | Bacteria | 6456 |
| 107 | Ga0466728_107024 | 3300042620 | Bacteria | 1973 |
| 108 | Ga0466703_157640 | 3300042636 | Bacteria | 4313 |
| 109 | Ga0466709_222588 | 3300042648 | Bacteria | 4088 |
| 110 | Ga0466700_428358 | 3300042600 | Bacteria | 10709 |
| 111 | Ga0466707_233995 | 3300042601 | Bacteria | 2575 |
| 112 | Ga0466713_084601 | 3300042602 | Bacteria | 2112 |
| 113 | Ga0466719_364311 | 3300042606 | Bacteria | 8124 |
| 114 | JGI24702J35022_10213639 | 3300002462 | Bacteria | 1109 |
| 115 | Ga0466697_140389 | 3300042611 | Bacteria | 2101 |
| 116 | Ga0466733_025416 | 3300042659 | Bacteria | 189255 |
| 117 | Ga0466733_134752 | 3300042659 | Bacteria | 3413 |
| 118 | Ga0466657_156355 | 3300042582 | Bacteria | 1471 |
| 119 | Ga0466690_264520 | 3300042590 | Bacteria | 31137 |
| 120 | Ga0466696_123492 | 3300042596 | Bacteria | 14968 |
| 121 | Ga0466696_227170 | 3300042596 | Bacteria | 9389 |
| 122 | Ga0466696_460040 | 3300042596 | Bacteria | 2822 |
| 123 | Ga0466726_096510 | 3300042619 | Bacteria | 17649 |
| 124 | Ga0466704_016776 | 3300042643 | Bacteria | 3845 |
| 125 | Ga0466727_101685 | 3300042655 | Bacteria | 17782 |
| 126 | Ga0466707_125409 | 3300042601 | Bacteria | 15243 |
| 127 | IMNBL1DRAFT_c0002283 | 3300000062 | Bacteria | 13508 |
| 128 | JGI24698J34947_10026762 | 3300002449 | Bacteria | 3062 |
| 129 | Ga0068305_10020657 | 3300005083 | Bacteria | 24279 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02775 | TPP_enzyme_C | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain | 80 | 231 | 0.81 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.