Protein Family IF05238

Metagenome Isolate
175 Members
49 Samples
165 Scaffolds
417.27 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_397462|Ga0466696_397462_979_2403
Length
474 aa
Sequence
MLGARCGSISALWMAGSFTYGDGLRGETRRPGFSVRNDASSRSNTKDLGREKMEYFVEQALNYTECLNKIRTKYGERVTILYHKNIRMGGIFGLFAKDGVEITGFTANNYAKNLNVATHASSMLAPSEPKKPLDFNEEKKRFVEMGGAAKKEEPTLMKVLEEMKSINEKLNVNAASPLRAEQAPHSTLVRLSEALALNDFSQSYIQNIIERCKKEISLESLNDYDAVQDKALEWIGETILIYKEAKVYKKPRVMVLVGPTGVGKTTTIAKLAAIYGIGSSAKPPVSVLMITIDAFRIGAKAQIEAYGNIMELPVSYVEDYDDLKRTIAQHSDDVDLILVDTIGKSPRDSVKLGEMKQLLDACGPHAEVHLAVAATTKSSDIKEILRQFEPFNYRSVIITKLDETTRMGNVISAISEKGKLVSYITDGQKVPSDIQTASVVRFLINLEGFHVKRSKIEERFPYGADERIQWKNRL

📊 Sample Types

Isolate 5.7%
Metagenome 94.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.7%
Kalotermitidae 28.6%
Unclassified 22.4%
Rhinotermitidae 8.2%
Termopsidae 6.1%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 172
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
10 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
11 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
12 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
13 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
16 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
17 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
18 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
21 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
22 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
23 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
24 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
25 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
30 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
31 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
32 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
36 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
37 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
40 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
41 2820016619 Unclassified Spirochaetes Nt197P3bin71 Isolate Unclassified
42 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
43 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
44 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
45 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
46 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
47 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
48 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
49 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466716_270520 3300042605 Bacteria 2057
2 Ga0466722_035441 3300042609 Bacteria 26035
3 Ga0466722_251234 3300042609 Bacteria 3567
4 Ga0466712_259449 3300042614 Bacteria 13229
5 Ga0466711_054871 3300042615 Bacteria 21842
6 Ga0466715_013788 3300042616 Bacteria 6967
7 Ga0466715_140625 3300042616 Bacteria 6882
8 Ga0466715_224726 3300042616 Bacteria 3567
9 Ga0466715_242240 3300042616 Bacteria 8392
10 Ga0466726_034817 3300042619 Bacteria 5491
11 Ga0466728_403318 3300042620 Bacteria 13612
12 Ga0415639_034817 3300038395 Bacteria 6037
13 Ga0466691_072046 3300042593 Bacteria 19393
14 Ga0466703_143773 3300042636 Bacteria 24097
15 Ga0466704_134136 3300042643 Bacteria 31349
16 Ga0466704_288508 3300042643 Bacteria 14887
17 Ga0466727_132560 3300042655 Bacteria 3399
18 AustNasuHG_c1001027 3300000089 Bacteria 10052
19 Ga0466719_023777 3300042606 Bacteria 34238
20 Ga0466711_216896 3300042615 Bacteria 77790
21 Ga0466726_098494 3300042619 Bacteria 33073
22 Ga0466726_147541 3300042619 Bacteria 36898
23 Ga0466726_277165 3300042619 Bacteria 2649
24 Ga0466726_382659 3300042619 Bacteria 18394
25 Ga0123353_10211973 3300010167 Bacteria 3037
26 Ga0466696_149692 3300042596 Bacteria 17333
27 Ga0466696_331190 3300042596 Bacteria 65152
28 Ga0466696_376400 3300042596 Bacteria 6647
29 Ga0466729_280285 3300042621 Bacteria 6748
30 Ga0466735_220266 3300042624 Bacteria 2114
31 Ga0466704_063886 3300042643 Bacteria 26674
32 Ga0466704_297862 3300042643 Bacteria 9900
33 Ga0466708_007489 3300042652 Bacteria 20731
34 Ga0466708_059408 3300042652 Bacteria 2007
35 Ga0466708_144606 3300042652 Bacteria 5948
36 JGI24698J34947_10017310 3300002449 Bacteria 3907
37 Ga0123357_10000117 3300009784 Bacteria 67273
38 Ga0466705_230922 3300042612 Bacteria 28521
39 Ga0466707_364693 3300042601 Bacteria 12364
40 Ga0466716_073141 3300042605 Bacteria 3953
41 Ga0466722_028325 3300042609 Bacteria 9494
42 Ga0466722_064604 3300042609 Bacteria 35013
43 Ga0466722_119857 3300042609 Bacteria 2744
44 Ga0466705_525731 3300042612 Bacteria 8810
45 Ga0466728_373591 3300042620 Bacteria 10747
46 Ga0456237_0001356 3300041968 Bacteria 3889
47 Ga0466690_433168 3300042590 Bacteria 3123
48 Ga0466692_102409 3300042591 Bacteria 11330
49 Ga0466694_031525 3300042594 Bacteria 37805
50 Ga0466699_167803 3300042597 Bacteria 2011
51 Ga0466735_219670 3300042624 Bacteria 1526
52 Ga0466703_362031 3300042636 Bacteria 1673
53 Ga0466704_556679 3300042643 Bacteria 57080
54 Ga0466705_202934 3300042612 Bacteria 22495
55 Ga0466707_071581 3300042601 Bacteria 1574
56 Ga0466720_071539 3300042607 Bacteria 31117
57 Ga0466721_025519 3300042608 Bacteria 3711
58 Ga0466715_134736 3300042616 Bacteria 16696
59 Ga0466715_301038 3300042616 Bacteria 16262
60 Ga0466723_200749 3300042618 Bacteria 72306
61 Ga0466726_167928 3300042619 Bacteria 3162
62 Ga0466726_310436 3300042619 Bacteria 6615
63 Ga0123356_10027718 3300010049 Bacteria 5308
64 Ga0123353_10016476 3300010167 Bacteria 10806
65 Ga0123353_10046275 3300010167 Bacteria 6911
66 Ga0123353_10120092 3300010167 Bacteria 4226
67 Ga0456237_0003136 3300041968 Bacteria 2687
68 Ga0466703_087402 3300042636 Bacteria 31745
69 Ga0466703_187864 3300042636 Bacteria 71803
70 Ga0466704_170845 3300042643 Bacteria 10005
71 Ga0466708_111503 3300042652 Bacteria 12449
72 Ga0466708_229267 3300042652 Bacteria 22598
73 Ga0466708_338747 3300042652 Bacteria 15647
74 Ga0466727_026473 3300042655 Bacteria 5160
75 Ga0466727_116649 3300042655 Bacteria 15287
76 JGI24695J34938_10006217 3300002450 Unclassified 7249
77 JGI24702J35022_10019335 3300002462 Bacteria 3705
78 Ga0466705_209789 3300042612 Bacteria 47591
79 Ga0466716_023523 3300042605 Bacteria 9758
80 Ga0466719_004821 3300042606 Bacteria 22594
81 Ga0466719_243719 3300042606 Bacteria 31002
82 Ga0466720_097759 3300042607 Bacteria 20759
83 Ga0466722_007302 3300042609 Bacteria 18801
84 Ga0466722_009932 3300042609 Bacteria 19464
85 Ga0466722_031083 3300042609 Bacteria 44330
86 Ga0466705_394593 3300042612 Bacteria 10227
87 Ga0466705_411719 3300042612 Bacteria 8684
88 Ga0466712_102687 3300042614 Bacteria 1766
89 Ga0466712_274858 3300042614 Bacteria 49650
90 Ga0466718_131430 3300042617 Unclassified 7401
91 Ga0466723_112988 3300042618 Bacteria 28451
92 Ga0123357_10073800 3300009784 Bacteria 4516
93 Ga0123353_10258551 3300010167 Bacteria 2691
94 Ga0456237_0000241 3300041968 Bacteria 7982
95 Ga0466690_144218 3300042590 Bacteria 24655
96 Ga0466690_202209 3300042590 Bacteria 3283
97 Ga0466691_182649 3300042593 Bacteria 13267
98 Ga0466696_183944 3300042596 Bacteria 11651
99 Ga0466703_250068 3300042636 Bacteria 27509
100 Ga0466708_449846 3300042652 Bacteria 2061
101 JGI24702J35022_10003206 3300002462 Bacteria 9889
102 JGI24702J35022_10027628 3300002462 Bacteria 3052
103 Ga0466705_069437 3300042612 Bacteria 13327
104 Ga0466719_495967 3300042606 Bacteria 34420
105 Ga0466711_379169 3300042615 Bacteria 28919
106 Ga0466715_077891 3300042616 Bacteria 3494
107 Ga0466715_142809 3300042616 Bacteria 11642
108 Ga0466715_564072 3300042616 Bacteria 16108
109 Ga0466726_492093 3300042619 Bacteria 1349
110 Ga0123353_10369067 3300010167 Bacteria 2153
111 Ga0415639_001130 3300038395 Bacteria 14482
112 Ga0466692_199825 3300042591 Bacteria 4718
113 Ga0466703_093126 3300042636 Bacteria 24260
114 Ga0466704_379885 3300042643 Bacteria 13731
115 AustNasuHG_c1002449 3300000089 Bacteria 6711
116 JGI24698J34947_10017971 3300002449 Bacteria 3827
117 Ga0466732_222241 3300042656 Bacteria 2892
118 Ga0466707_268790 3300042601 Bacteria 2861
119 Ga0466716_505875 3300042605 Bacteria 2037
120 Ga0466719_544255 3300042606 Bacteria 14999
121 Ga0466722_115236 3300042609 Bacteria 8566
122 Ga0466722_253920 3300042609 Unclassified 1514
123 Ga0466723_072479 3300042618 Bacteria 28033
124 Ga0466723_080092 3300042618 Bacteria 7611
125 Ga0466723_135937 3300042618 Bacteria 21870
126 Ga0466726_061649 3300042619 Bacteria 17192
127 Ga0466726_139023 3300042619 Bacteria 48573
128 Ga0466726_375410 3300042619 Bacteria 11809
129 Ga0466728_007179 3300042620 Bacteria 31291
130 Ga0123357_10005590 3300009784 Bacteria 15106
131 Ga0123353_10195972 3300010167 Bacteria 3184
132 Ga0123353_10423597 3300010167 Bacteria 1971
133 Ga0415639_051838 3300038395 Bacteria 5533
134 Ga0466690_364547 3300042590 Bacteria 36984
135 Ga0466692_111799 3300042591 Bacteria 1960
136 Ga0466692_201021 3300042591 Bacteria 9567
137 Ga0466691_116291 3300042593 Bacteria 7721
138 Ga0466691_118331 3300042593 Bacteria 63226
139 Ga0466691_129862 3300042593 Bacteria 25527
140 Ga0466699_243834 3300042597 Bacteria 9207
141 Ga0466699_291421 3300042597 Bacteria 2675
142 Ga0466704_120913 3300042643 Bacteria 48720
143 Ga0466727_134172 3300042655 Bacteria 2407
144 Ga0466705_007122 3300042612 Bacteria 14710
145 Ga0466705_104454 3300042612 Bacteria 2211
146 Ga0466706_157465 3300042599 Bacteria 8538
147 Ga0466716_083757 3300042605 Bacteria 17526
148 Ga0466719_291744 3300042606 Bacteria 11276
149 Ga0466722_026120 3300042609 Bacteria 11257
150 Ga0466712_181647 3300042614 Bacteria 18811
151 Ga0466711_026706 3300042615 Bacteria 17084
152 Ga0466715_462513 3300042616 Bacteria 17159
153 Ga0466723_199918 3300042618 Bacteria 15235
154 Ga0466726_335483 3300042619 Bacteria 23284
155 Ga0466728_040479 3300042620 Bacteria 30440
156 Ga0123357_10275439 3300009784 Bacteria 1749
157 Ga0123355_10023236 3300009826 Bacteria 9955
158 Ga0466691_006370 3300042593 Bacteria 22207
159 Ga0466694_124255 3300042594 Bacteria 2415
160 Ga0466696_397462 3300042596 Bacteria 14126
161 Ga0466699_134255 3300042597 Bacteria 2805
162 Ga0466709_402198 3300042648 Bacteria 9829
163 JGI24698J34947_10002844 3300002449 Bacteria 9384
164 JGI24698J34947_10004036 3300002449 Bacteria 7976
165 JGI24695J34938_10017874 3300002450 Bacteria 3561

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00448 SRP54 SRP54-type protein, GTPase domain 251 443 0.87

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.