Protein Family IF05194
Metagenome
Isolate
156
Members
63
Samples
137
Scaffolds
216.72
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_253210|Ga0466696_253210_171111_171812
- Length
- 233 aa
- Sequence
- LKKKWGKQKKSKNSSRMIIKIGKAGDNDYVVNHPHVSRYHARLTRGSDGCLLLEDIGSANGTFVNGSQIVKKRVSPTDTIILGDSYKLDLPSVLKANNDYSDEFDRLKEVYDKYIQQKVKIQSSNQFKTRLFQALPFALIGIVGVIAGTLGKGNPALFGISLFVTICVPTIGIYLGAKQSAKIPRQLQDLSNQFKIDYVCPRCGTFLGEIPWESLANKKQCPVSTCKAKWIKE
Sample Types
Isolate
12.2%
Metagenome
87.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
30.6%
Termitidae
25.8%
Kalotermitidae
22.6%
Termopsidae
6.5%
Rhinotermitidae
4.8%
Unclassified
4.8%
Passalidae
3.2%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
149
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 2 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 3 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 4 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 14 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 15 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 16 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 22 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 28 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 29 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 30 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 37 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 38 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 39 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 40 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 41 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 42 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 43 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 44 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 47 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 48 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 49 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 50 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 51 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 52 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 55 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 56 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 57 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 58 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 59 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 60 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 61 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 62 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 63 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466691_040271 | 3300042593 | Bacteria | 19293 |
| 2 | Ga0466691_160182 | 3300042593 | Bacteria | 7247 |
| 3 | Ga0466696_331647 | 3300042596 | Bacteria | 5619 |
| 4 | Ga0123353_10486194 | 3300010167 | Bacteria | 1804 |
| 5 | Ga0466707_363930 | 3300042601 | Bacteria | 6134 |
| 6 | Ga0466713_012307 | 3300042602 | Bacteria | 58290 |
| 7 | Ga0466719_538301 | 3300042606 | Bacteria | 9151 |
| 8 | Ga0466722_082515 | 3300042609 | Bacteria | 19321 |
| 9 | JGI24698J34947_10012627 | 3300002449 | Bacteria | 4627 |
| 10 | JGI24702J35022_10004205 | 3300002462 | Bacteria | 8597 |
| 11 | Ga0466735_195740 | 3300042624 | Bacteria | 2592 |
| 12 | Ga0466704_508701 | 3300042643 | Bacteria | 12981 |
| 13 | Ga0466709_352321 | 3300042648 | Bacteria | 1720 |
| 14 | Ga0466727_162954 | 3300042655 | Bacteria | 2480 |
| 15 | Ga0466715_006002 | 3300042616 | Bacteria | 6808 |
| 16 | Ga0466728_267508 | 3300042620 | Bacteria | 2655 |
| 17 | Ga0466733_044465 | 3300042659 | Unclassified | 1847 |
| 18 | Ga0466690_013408 | 3300042590 | Bacteria | 36434 |
| 19 | Ga0466690_351619 | 3300042590 | Bacteria | 10399 |
| 20 | Ga0466692_049252 | 3300042591 | Bacteria | 14960 |
| 21 | Ga0466694_092194 | 3300042594 | Bacteria | 1363 |
| 22 | Ga0466707_420122 | 3300042601 | Bacteria | 5080 |
| 23 | IMNBL1DRAFT_c0003971 | 3300000062 | Bacteria | 9135 |
| 24 | Ga0072941_1719791 | 3300005201 | Bacteria | 1016 |
| 25 | Ga0466705_110652 | 3300042612 | Bacteria | 2152 |
| 26 | Ga0466705_206959 | 3300042612 | Bacteria | 27598 |
| 27 | Ga0466735_064493 | 3300042624 | Bacteria | 1791 |
| 28 | Ga0466704_057446 | 3300042643 | Bacteria | 36351 |
| 29 | Ga0466704_211074 | 3300042643 | Bacteria | 3259 |
| 30 | Ga0466704_234531 | 3300042643 | Bacteria | 25098 |
| 31 | Ga0466704_239730 | 3300042643 | Bacteria | 3855 |
| 32 | Ga0466704_558745 | 3300042643 | Bacteria | 2417 |
| 33 | Ga0466725_094029 | 3300042654 | Bacteria | 12000 |
| 34 | Ga0466690_428066 | 3300042590 | Bacteria | 3039 |
| 35 | Ga0466693_015353 | 3300042592 | Bacteria | 2833 |
| 36 | Ga0466696_085675 | 3300042596 | Bacteria | 7447 |
| 37 | Ga0466696_121973 | 3300042596 | Bacteria | 7185 |
| 38 | Ga0466706_191250 | 3300042599 | Bacteria | 3027 |
| 39 | Ga0466707_207546 | 3300042601 | Bacteria | 8870 |
| 40 | Ga0466717_091285 | 3300042604 | Bacteria | 4261 |
| 41 | Ga0466722_042812 | 3300042609 | Bacteria | 110303 |
| 42 | JGI24702J35022_10064309 | 3300002462 | Bacteria | 1967 |
| 43 | Ga0068302_10027905 | 3300005071 | Bacteria | 9012 |
| 44 | Ga0068305_10087386 | 3300005083 | Bacteria | 20604 |
| 45 | Ga0466731_328063 | 3300042622 | Bacteria | 8562 |
| 46 | Ga0466703_264243 | 3300042636 | Bacteria | 16326 |
| 47 | Ga0466704_614997 | 3300042643 | Bacteria | 18421 |
| 48 | Ga0466709_197620 | 3300042648 | Bacteria | 10966 |
| 49 | Ga0466708_059059 | 3300042652 | Bacteria | 19235 |
| 50 | Ga0466727_243830 | 3300042655 | Bacteria | 3573 |
| 51 | Ga0466711_044603 | 3300042615 | Bacteria | 28836 |
| 52 | Ga0466711_115005 | 3300042615 | Bacteria | 14076 |
| 53 | Ga0466715_130141 | 3300042616 | Bacteria | 13479 |
| 54 | Ga0466723_186332 | 3300042618 | Bacteria | 21025 |
| 55 | Ga0466723_217143 | 3300042618 | Bacteria | 8876 |
| 56 | Ga0466656_086176 | 3300042550 | Bacteria | 1166 |
| 57 | Ga0466690_307546 | 3300042590 | Bacteria | 9246 |
| 58 | Ga0466692_038856 | 3300042591 | Bacteria | 66664 |
| 59 | Ga0466706_248713 | 3300042599 | Bacteria | 1928 |
| 60 | Ga0466713_065086 | 3300042602 | Bacteria | 42766 |
| 61 | Ga0466716_021027 | 3300042605 | Bacteria | 3901 |
| 62 | Ga0466719_498059 | 3300042606 | Bacteria | 3708 |
| 63 | 2227491324 | 2225789004 | Bacteria | 4074 |
| 64 | JGI24702J35022_10016383 | 3300002462 | Unclassified | 4063 |
| 65 | JGI24702J35022_10124632 | 3300002462 | Bacteria | 1425 |
| 66 | Ga0068305_10043369 | 3300005083 | Bacteria | 12829 |
| 67 | Ga0466711_290544 | 3300042615 | Bacteria | 3474 |
| 68 | Ga0466711_438584 | 3300042615 | Bacteria | 48599 |
| 69 | Ga0466726_140379 | 3300042619 | Bacteria | 4579 |
| 70 | Ga0466726_430046 | 3300042619 | Unclassified | 7940 |
| 71 | Ga0466733_020555 | 3300042659 | Bacteria | 39431 |
| 72 | Ga0466690_286205 | 3300042590 | Bacteria | 6111 |
| 73 | Ga0466691_020135 | 3300042593 | Bacteria | 14428 |
| 74 | Ga0466696_124291 | 3300042596 | Bacteria | 13839 |
| 75 | Ga0466706_100027 | 3300042599 | Bacteria | 16600 |
| 76 | Ga0466707_193393 | 3300042601 | Bacteria | 2757 |
| 77 | Ga0466716_174114 | 3300042605 | Bacteria | 22194 |
| 78 | Ga0466719_533213 | 3300042606 | Bacteria | 5103 |
| 79 | 2227502407 | 2225789004 | Bacteria | 19159 |
| 80 | Ga0068302_10124877 | 3300005071 | Unclassified | 1199 |
| 81 | Ga0068302_10501829 | 3300005071 | Bacteria | 2024 |
| 82 | Ga0466705_194260 | 3300042612 | Unclassified | 2641 |
| 83 | Ga0466729_282313 | 3300042621 | Bacteria | 11492 |
| 84 | Ga0466703_382381 | 3300042636 | Bacteria | 9995 |
| 85 | Ga0466704_501502 | 3300042643 | Bacteria | 1548 |
| 86 | Ga0466727_147968 | 3300042655 | Bacteria | 12219 |
| 87 | Ga0466727_304061 | 3300042655 | Bacteria | 10297 |
| 88 | Ga0466711_006850 | 3300042615 | Bacteria | 10439 |
| 89 | Ga0466711_358068 | 3300042615 | Bacteria | 3604 |
| 90 | Ga0466715_327025 | 3300042616 | Bacteria | 19853 |
| 91 | Ga0466715_553486 | 3300042616 | Bacteria | 14649 |
| 92 | Ga0466723_072065 | 3300042618 | Bacteria | 25909 |
| 93 | Ga0466726_313628 | 3300042619 | Bacteria | 6715 |
| 94 | Ga0466693_344478 | 3300042592 | Bacteria | 1769 |
| 95 | Ga0466691_039832 | 3300042593 | Bacteria | 18124 |
| 96 | Ga0466696_253210 | 3300042596 | Bacteria | 201850 |
| 97 | Ga0466701_094007 | 3300042598 | Bacteria | 2217 |
| 98 | Ga0466713_116734 | 3300042602 | Bacteria | 36028 |
| 99 | JGI24702J35022_10000351 | 3300002462 | Bacteria | 27249 |
| 100 | JGI24702J35022_10015057 | 3300002462 | Bacteria | 4262 |
| 101 | JGI24705J35276_12195951 | 3300002504 | Bacteria | 1533 |
| 102 | JGI24696J40584_12937341 | 3300002834 | Bacteria | 1601 |
| 103 | Ga0068302_10058165 | 3300005071 | Bacteria | 1913 |
| 104 | Ga0072940_1175475 | 3300005200 | Bacteria | 1054 |
| 105 | Ga0466703_008497 | 3300042636 | Bacteria | 10412 |
| 106 | Ga0466703_158188 | 3300042636 | Bacteria | 17067 |
| 107 | Ga0466715_077237 | 3300042616 | Bacteria | 28902 |
| 108 | Ga0466690_310163 | 3300042590 | Bacteria | 12898 |
| 109 | Ga0123356_10540724 | 3300010049 | Bacteria | 1325 |
| 110 | Ga0123353_10508502 | 3300010167 | Bacteria | 1752 |
| 111 | Ga0466716_278695 | 3300042605 | Bacteria | 8960 |
| 112 | JGI24702J35022_10010321 | 3300002462 | Bacteria | 5221 |
| 113 | JGI24702J35022_10018882 | 3300002462 | Bacteria | 3755 |
| 114 | Ga0466705_103612 | 3300042612 | Bacteria | 55765 |
| 115 | Ga0466703_200437 | 3300042636 | Bacteria | 16741 |
| 116 | Ga0466704_567752 | 3300042643 | Unclassified | 14978 |
| 117 | Ga0466708_290271 | 3300042652 | Bacteria | 28875 |
| 118 | Ga0466727_104826 | 3300042655 | Unclassified | 8215 |
| 119 | Ga0466705_428831 | 3300042612 | Bacteria | 1174 |
| 120 | Ga0466711_002482 | 3300042615 | Bacteria | 3082 |
| 121 | Ga0466733_179279 | 3300042659 | Bacteria | 13125 |
| 122 | Ga0466690_257661 | 3300042590 | Bacteria | 8098 |
| 123 | Ga0466714_169958 | 3300042603 | Bacteria | 1165 |
| 124 | Ga0466716_129706 | 3300042605 | Bacteria | 33732 |
| 125 | Ga0466722_083496 | 3300042609 | Bacteria | 6509 |
| 126 | Ga0466722_140029 | 3300042609 | Bacteria | 11837 |
| 127 | JGI24705J35276_12237621 | 3300002504 | Bacteria | 12151 |
| 128 | Ga0068305_10114763 | 3300005083 | Bacteria | 12480 |
| 129 | Ga0466705_037971 | 3300042612 | Bacteria | 10937 |
| 130 | Ga0466705_093679 | 3300042612 | Bacteria | 13250 |
| 131 | Ga0466703_420415 | 3300042636 | Bacteria | 2988 |
| 132 | Ga0466704_281477 | 3300042643 | Bacteria | 13112 |
| 133 | Ga0466709_002728 | 3300042648 | Bacteria | 5566 |
| 134 | Ga0466709_180417 | 3300042648 | Bacteria | 5718 |
| 135 | Ga0466711_192796 | 3300042615 | Bacteria | 14635 |
| 136 | Ga0466711_212677 | 3300042615 | Bacteria | 9371 |
| 137 | Ga0466728_278920 | 3300042620 | Bacteria | 10302 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00498 | GO:0005515 | protein binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.