Protein Family IF05176
Metagenome
Isolate
117
Members
49
Samples
113
Scaffolds
262.59
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_195640|Ga0466696_195640_3740_4594
- Length
- 284 aa
- Sequence
- MIPELAITQWRSVVPWSDVKQVEQDLIICRTLVAIFSDEFLAERLAFRGGTALHKLYLSPQPRYSEDIDLVQINSEPIKPTIGRLRDVLSFLGEPKVKQKRSNNTLIFRMESSVLPILPIKLKVEINCREHFNILGLEEVNFSMVNLWFSGNCKIKTYKLNELIGTKVRALYERRKGRDLYDLYKALQNPALNPENVIYCFKKYMEWEEKKPTYKLYVSNMEDKMQKDEFLGDTKTLLRPDEVYDAKEAYKIVKEKIINKLATKEELQQETVDRDNSSQEITKS
Sample Types
Isolate
3.4%
Metagenome
96.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.9%
Kalotermitidae
25.0%
Unclassified
10.4%
Termopsidae
6.2%
Passalidae
4.2%
Rhinotermitidae
4.2%
Hodotermitidae
2.1%
Taxonomy
Archaea
0
Bacteria
95
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 10 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 11 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 12 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 13 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 14 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 15 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 16 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 21 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 22 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 23 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 24 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 25 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 32 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 33 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 40 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 41 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 42 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 43 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 44 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 45 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 46 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 47 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 48 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 49 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_142669 | 3300042611 | Bacteria | 1464 |
| 2 | Ga0466705_194234 | 3300042612 | Bacteria | 3580 |
| 3 | Ga0466711_033309 | 3300042615 | Bacteria | 1392 |
| 4 | Ga0466701_038289 | 3300042598 | Bacteria | 7181 |
| 5 | Ga0466702_009442 | 3300042635 | Bacteria | 5622 |
| 6 | Ga0466708_029408 | 3300042652 | Bacteria | 10079 |
| 7 | JGI24702J35022_10060282 | 3300002462 | Bacteria | 2028 |
| 8 | Ga0123357_10004018 | 3300009784 | Bacteria | 17112 |
| 9 | Ga0123353_10069440 | 3300010167 | Bacteria | 5660 |
| 10 | Ga0123354_10242917 | 3300010882 | Bacteria | 1847 |
| 11 | Ga0466690_114655 | 3300042590 | Bacteria | 3221 |
| 12 | Ga0466692_045859 | 3300042591 | Bacteria | 8936 |
| 13 | Ga0466694_040621 | 3300042594 | Bacteria | 4338 |
| 14 | Ga0466696_195640 | 3300042596 | Bacteria | 8760 |
| 15 | Ga0466705_114485 | 3300042612 | Unclassified | 2158 |
| 16 | Ga0466711_018525 | 3300042615 | Bacteria | 3577 |
| 17 | Ga0466711_192425 | 3300042615 | Bacteria | 3047 |
| 18 | Ga0466715_006597 | 3300042616 | Bacteria | 3210 |
| 19 | Ga0466719_270573 | 3300042606 | Bacteria | 1403 |
| 20 | Ga0466722_090603 | 3300042609 | Bacteria | 2142 |
| 21 | Ga0466703_041043 | 3300042636 | Bacteria | 5663 |
| 22 | Ga0466725_222087 | 3300042654 | Unclassified | 1385 |
| 23 | JGI24702J35022_10144370 | 3300002462 | Bacteria | 1331 |
| 24 | JGI24696J40584_12950504 | 3300002834 | Bacteria | 2155 |
| 25 | Ga0068302_10002008 | 3300005071 | Unclassified | 2034 |
| 26 | Ga0068302_10129817 | 3300005071 | Bacteria | 1169 |
| 27 | Ga0123356_10124789 | 3300010049 | Bacteria | 2511 |
| 28 | Ga0123356_10492784 | 3300010049 | Bacteria | 1380 |
| 29 | Ga0123353_10086912 | 3300010167 | Bacteria | 5037 |
| 30 | Ga0123353_10903157 | 3300010167 | Bacteria | 1202 |
| 31 | Ga0466694_191972 | 3300042594 | Bacteria | 2207 |
| 32 | Ga0466696_110381 | 3300042596 | Bacteria | 2592 |
| 33 | Ga0466705_500289 | 3300042612 | Bacteria | 21534 |
| 34 | Ga0466710_018077 | 3300042613 | Bacteria | 2382 |
| 35 | Ga0466728_075697 | 3300042620 | Bacteria | 5181 |
| 36 | Ga0466701_046038 | 3300042598 | Unclassified | 4272 |
| 37 | Ga0466706_032438 | 3300042599 | Bacteria | 44086 |
| 38 | Ga0466713_012084 | 3300042602 | Bacteria | 5222 |
| 39 | Ga0466719_403678 | 3300042606 | Bacteria | 11934 |
| 40 | Ga0466698_207426 | 3300042610 | Bacteria | 1479 |
| 41 | Ga0466725_093810 | 3300042654 | Bacteria | 2053 |
| 42 | IMNBL1DRAFT_c0020236 | 3300000062 | Bacteria | 2701 |
| 43 | JGI24702J35022_10041250 | 3300002462 | Bacteria | 2460 |
| 44 | Ga0123356_10119687 | 3300010049 | Bacteria | 2559 |
| 45 | Ga0123353_10784010 | 3300010167 | Bacteria | 1319 |
| 46 | Ga0123354_10001938 | 3300010882 | Bacteria | 26389 |
| 47 | Ga0123354_10081015 | 3300010882 | Bacteria | 4590 |
| 48 | Ga0466691_078433 | 3300042593 | Bacteria | 2412 |
| 49 | Ga0466705_168781 | 3300042612 | Bacteria | 6960 |
| 50 | Ga0466705_228589 | 3300042612 | Bacteria | 4051 |
| 51 | Ga0466717_208889 | 3300042604 | Bacteria | 2075 |
| 52 | Ga0466697_018276 | 3300042611 | Bacteria | 1122 |
| 53 | Ga0466735_163933 | 3300042624 | Bacteria | 1831 |
| 54 | Ga0466703_022682 | 3300042636 | Bacteria | 12633 |
| 55 | 2227517705 | 2225789004 | Unclassified | 3405 |
| 56 | AustNasuHG_c1003818 | 3300000089 | Bacteria | 5427 |
| 57 | JGI24695J34938_10018978 | 3300002450 | Unclassified | 3420 |
| 58 | JGI24702J35022_10002057 | 3300002462 | Bacteria | 12415 |
| 59 | JGI24702J35022_10324666 | 3300002462 | Unclassified | 914 |
| 60 | Ga0123357_10081141 | 3300009784 | Bacteria | 4264 |
| 61 | Ga0123357_10163558 | 3300009784 | Bacteria | 2659 |
| 62 | Ga0123356_10221197 | 3300010049 | Bacteria | 1950 |
| 63 | Ga0123353_10188627 | 3300010167 | Bacteria | 3257 |
| 64 | Ga0123353_10882702 | 3300010167 | Unclassified | 1220 |
| 65 | Ga0123354_10577726 | 3300010882 | Unclassified | 834 |
| 66 | Ga0466697_268453 | 3300042611 | Unclassified | 1998 |
| 67 | Ga0466728_216007 | 3300042620 | Bacteria | 3594 |
| 68 | Ga0466719_022791 | 3300042606 | Unclassified | 1177 |
| 69 | Ga0466722_010955 | 3300042609 | Bacteria | 2389 |
| 70 | Ga0466734_097782 | 3300042623 | Bacteria | 2291 |
| 71 | Ga0466709_209760 | 3300042648 | Unclassified | 15691 |
| 72 | Ga0072941_1286452 | 3300005201 | Unclassified | 1148 |
| 73 | Ga0123356_10144762 | 3300010049 | Bacteria | 2350 |
| 74 | Ga0123353_10460144 | 3300010167 | Bacteria | 1870 |
| 75 | Ga0123354_10180401 | 3300010882 | Bacteria | 2413 |
| 76 | Ga0466693_414917 | 3300042592 | Bacteria | 1393 |
| 77 | Ga0466733_122580 | 3300042659 | Unclassified | 3309 |
| 78 | Ga0466705_528597 | 3300042612 | Unclassified | 1930 |
| 79 | Ga0466706_288776 | 3300042599 | Bacteria | 9247 |
| 80 | Ga0466707_095838 | 3300042601 | Bacteria | 8359 |
| 81 | Ga0466717_029462 | 3300042604 | Bacteria | 1827 |
| 82 | Ga0466703_146084 | 3300042636 | Bacteria | 3160 |
| 83 | JGI24702J35022_10011284 | 3300002462 | Bacteria | 4982 |
| 84 | JGI24696J40584_12937707 | 3300002834 | Unclassified | 1609 |
| 85 | Ga0123357_10114486 | 3300009784 | Unclassified | 3424 |
| 86 | Ga0123356_10127423 | 3300010049 | Bacteria | 2488 |
| 87 | Ga0123356_10191749 | 3300010049 | Bacteria | 2075 |
| 88 | Ga0123353_10326087 | 3300010167 | Bacteria | 2327 |
| 89 | Ga0123354_10120055 | 3300010882 | Unclassified | 3401 |
| 90 | Ga0123354_10140282 | 3300010882 | Bacteria | 2994 |
| 91 | Ga0466690_044103 | 3300042590 | Bacteria | 4693 |
| 92 | Ga0466691_001648 | 3300042593 | Bacteria | 10794 |
| 93 | Ga0466696_096298 | 3300042596 | Bacteria | 2134 |
| 94 | Ga0466696_371976 | 3300042596 | Bacteria | 3531 |
| 95 | Ga0466705_199232 | 3300042612 | Bacteria | 3732 |
| 96 | Ga0466710_043869 | 3300042613 | Bacteria | 3009 |
| 97 | Ga0466704_418500 | 3300042643 | Bacteria | 9077 |
| 98 | 2227519073 | 2225789004 | Unclassified | 17485 |
| 99 | IMNBL1DRAFT_c0003368 | 3300000062 | Bacteria | 10364 |
| 100 | JGI24705J35276_12232362 | 3300002504 | Unclassified | 4299 |
| 101 | Ga0123357_10609230 | 3300009784 | Unclassified | 833 |
| 102 | Ga0123354_10321609 | 3300010882 | Bacteria | 1427 |
| 103 | Ga0466694_182210 | 3300042594 | Unclassified | 1081 |
| 104 | Ga0466699_330119 | 3300042597 | Bacteria | 2860 |
| 105 | Ga0466711_512097 | 3300042615 | Bacteria | 10031 |
| 106 | Ga0466726_196544 | 3300042619 | Bacteria | 2226 |
| 107 | Ga0466707_310966 | 3300042601 | Bacteria | 2163 |
| 108 | Ga0466717_015405 | 3300042604 | Bacteria | 1957 |
| 109 | Ga0466734_149220 | 3300042623 | Bacteria | 3509 |
| 110 | Ga0466704_402082 | 3300042643 | Bacteria | 2774 |
| 111 | Ga0072941_1320176 | 3300005201 | Bacteria | 977 |
| 112 | Ga0466656_041077 | 3300042550 | Bacteria | 1499 |
| 113 | Ga0466695_389790 | 3300042595 | Bacteria | 1050 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042601 | Ga0466707_310966 | Ga0466707_310966_294_983 | 229 |
| 2 | 3300042604 | Ga0466717_208889 | Ga0466717_208889_37_729 | 230 |
| 3 | 3300042610 | Ga0466698_207426 | Ga0466698_207426_362_1081 | 239 |
| 4 | 3300009784 | Ga0123357_10081141 | Ga0123357_100811411 | 244 |
| 5 | 3300010882 | Ga0123354_10321609 | Ga0123354_103216092 | 249 |
| 6 | 3300005071 | Ga0068302_10129817 | Ga0068302_101298172 | 254 |
| 7 | 2225789004 | 2227517705 | 2228018043 | 256 |
| 8 | 3300000062 | IMNBL1DRAFT_c0003368 | IMNBL1DRAFT_00033689 | 257 |
| 9 | 3300042590 | Ga0466690_114655 | Ga0466690_114655_1005_1781 | 258 |
| 10 | 3300042606 | Ga0466719_403678 | Ga0466719_403678_7806_8582 | 258 |
| 11 | 3300000089 | AustNasuHG_c1003818 | AustNasuHG_10038186 | 262 |
| 12 | 3300042550 | Ga0466656_041077 | Ga0466656_041077_635_1423 | 262 |
| 13 | 3300042590 | Ga0466690_044103 | Ga0466690_044103_572_1360 | 262 |
| 14 | 3300042591 | Ga0466692_045859 | Ga0466692_045859_1077_1865 | 262 |
| 15 | 3300042592 | Ga0466693_414917 | Ga0466693_414917_100_888 | 262 |
| 16 | 3300042593 | Ga0466691_078433 | Ga0466691_078433_225_1013 | 262 |
| 17 | 3300042594 | Ga0466694_182210 | Ga0466694_182210_274_1062 | 262 |
| 18 | 3300042594 | Ga0466694_191972 | Ga0466694_191972_930_1718 | 262 |
| 19 | 3300042595 | Ga0466695_389790 | Ga0466695_389790_229_1017 | 262 |
| 20 | 3300042596 | Ga0466696_371976 | Ga0466696_371976_2309_3097 | 262 |
| 21 | 3300042598 | Ga0466701_038289 | Ga0466701_038289_912_1700 | 262 |
| 22 | 3300042599 | Ga0466706_032438 | Ga0466706_032438_40853_41641 | 262 |
| 23 | 3300042599 | Ga0466706_288776 | Ga0466706_288776_2143_2931 | 262 |
| 24 | 3300042601 | Ga0466707_095838 | Ga0466707_095838_108_896 | 262 |
| 25 | 3300042602 | Ga0466713_012084 | Ga0466713_012084_2654_3442 | 262 |
| 26 | 3300042604 | Ga0466717_015405 | Ga0466717_015405_190_978 | 262 |
| 27 | 3300042604 | Ga0466717_029462 | Ga0466717_029462_297_1085 | 262 |
| 28 | 3300042606 | Ga0466719_022791 | Ga0466719_022791_122_910 | 262 |
| 29 | 3300042606 | Ga0466719_270573 | Ga0466719_270573_456_1244 | 262 |
| 30 | 3300042609 | Ga0466722_010955 | Ga0466722_010955_1326_2114 | 262 |
| 31 | 3300042611 | Ga0466697_018276 | Ga0466697_018276_296_1084 | 262 |
| 32 | 3300042611 | Ga0466697_142669 | Ga0466697_142669_534_1322 | 262 |
| 33 | 3300042611 | Ga0466697_268453 | Ga0466697_268453_966_1754 | 262 |
| 34 | 3300042612 | Ga0466705_114485 | Ga0466705_114485_1027_1815 | 262 |
| 35 | 3300042612 | Ga0466705_194234 | Ga0466705_194234_1166_1954 | 262 |
| 36 | 3300042612 | Ga0466705_199232 | Ga0466705_199232_1559_2347 | 262 |
| 37 | 3300042612 | Ga0466705_500289 | Ga0466705_500289_19295_20083 | 262 |
| 38 | 3300042612 | Ga0466705_528597 | Ga0466705_528597_1033_1821 | 262 |
| 39 | 3300042613 | Ga0466710_018077 | Ga0466710_018077_537_1325 | 262 |
| 40 | 3300042613 | Ga0466710_043869 | Ga0466710_043869_1500_2288 | 262 |
| 41 | 3300042615 | Ga0466711_033309 | Ga0466711_033309_371_1159 | 262 |
| 42 | 3300042615 | Ga0466711_192425 | Ga0466711_192425_1652_2440 | 262 |
| 43 | 3300042615 | Ga0466711_512097 | Ga0466711_512097_8143_8931 | 262 |
| 44 | 3300042616 | Ga0466715_006597 | Ga0466715_006597_892_1680 | 262 |
| 45 | 3300042619 | Ga0466726_196544 | Ga0466726_196544_287_1075 | 262 |
| 46 | 3300042620 | Ga0466728_075697 | Ga0466728_075697_2589_3377 | 262 |
| 47 | 3300042620 | Ga0466728_216007 | Ga0466728_216007_1058_1846 | 262 |
| 48 | 3300042623 | Ga0466734_097782 | Ga0466734_097782_260_1048 | 262 |
| 49 | 3300042623 | Ga0466734_149220 | Ga0466734_149220_772_1560 | 262 |
| 50 | 3300042624 | Ga0466735_163933 | Ga0466735_163933_1008_1796 | 262 |
| 51 | 3300042643 | Ga0466704_402082 | Ga0466704_402082_233_1021 | 262 |
| 52 | 3300042643 | Ga0466704_418500 | Ga0466704_418500_7215_8003 | 262 |
| 53 | 3300042654 | Ga0466725_093810 | Ga0466725_093810_375_1163 | 262 |
| 54 | 3300042654 | Ga0466725_222087 | Ga0466725_222087_315_1103 | 262 |
| 55 | 3300042659 | Ga0466733_122580 | Ga0466733_122580_796_1584 | 262 |
| 56 | iso_pr_bacteria | 2778260941 | 2778358885 | 262 |
| 57 | iso_pr_bacteria | 2820789850 | 2820792727 | 262 |
| 58 | iso_pr_bacteria | 2967483437 | 2967487171 | 262 |
| 59 | 3300002450 | JGI24695J34938_10018978 | JGI24695J34938_100189783 | 263 |
| 60 | 3300002462 | JGI24702J35022_10002057 | JGI24702J35022_1000205712 | 263 |
| 61 | 3300002462 | JGI24702J35022_10011284 | JGI24702J35022_100112842 | 263 |
| 62 | 3300002462 | JGI24702J35022_10041250 | JGI24702J35022_100412503 | 263 |
| 63 | 3300002462 | JGI24702J35022_10060282 | JGI24702J35022_100602822 | 263 |
| 64 | 3300002462 | JGI24702J35022_10144370 | JGI24702J35022_101443702 | 263 |
| 65 | 3300002462 | JGI24702J35022_10324666 | JGI24702J35022_103246661 | 263 |
| 66 | 3300002504 | JGI24705J35276_12232362 | JGI24705J35276_122323626 | 263 |
| 67 | 3300002834 | JGI24696J40584_12937707 | JGI24696J40584_129377072 | 263 |
| 68 | 3300002834 | JGI24696J40584_12950504 | JGI24696J40584_129505043 | 263 |
| 69 | 3300005071 | Ga0068302_10002008 | Ga0068302_100020081 | 263 |
| 70 | 3300005201 | Ga0072941_1320176 | Ga0072941_13201761 | 263 |
| 71 | 3300009784 | Ga0123357_10004018 | Ga0123357_100040184 | 263 |
| 72 | 3300009784 | Ga0123357_10114486 | Ga0123357_101144864 | 263 |
| 73 | 3300009784 | Ga0123357_10163558 | Ga0123357_101635583 | 263 |
| 74 | 3300009784 | Ga0123357_10609230 | Ga0123357_106092301 | 263 |
| 75 | 3300010049 | Ga0123356_10119687 | Ga0123356_101196873 | 263 |
| 76 | 3300010049 | Ga0123356_10124789 | Ga0123356_101247894 | 263 |
| 77 | 3300010049 | Ga0123356_10127423 | Ga0123356_101274233 | 263 |
| 78 | 3300010049 | Ga0123356_10144762 | Ga0123356_101447624 | 263 |
| 79 | 3300010049 | Ga0123356_10191749 | Ga0123356_101917492 | 263 |
| 80 | 3300010049 | Ga0123356_10221197 | Ga0123356_102211973 | 263 |
| 81 | 3300010049 | Ga0123356_10492784 | Ga0123356_104927842 | 263 |
| 82 | 3300010167 | Ga0123353_10086912 | Ga0123353_100869122 | 263 |
| 83 | 3300010167 | Ga0123353_10188627 | Ga0123353_101886273 | 263 |
| 84 | 3300010167 | Ga0123353_10326087 | Ga0123353_103260872 | 263 |
| 85 | 3300010167 | Ga0123353_10460144 | Ga0123353_104601442 | 263 |
| 86 | 3300010167 | Ga0123353_10784010 | Ga0123353_107840101 | 263 |
| 87 | 3300010167 | Ga0123353_10903157 | Ga0123353_109031572 | 263 |
| 88 | 3300010882 | Ga0123354_10001938 | Ga0123354_1000193820 | 263 |
| 89 | 3300010882 | Ga0123354_10081015 | Ga0123354_100810153 | 263 |
| 90 | 3300010882 | Ga0123354_10120055 | Ga0123354_101200552 | 263 |
| 91 | 3300010882 | Ga0123354_10140282 | Ga0123354_101402823 | 263 |
| 92 | 3300010882 | Ga0123354_10242917 | Ga0123354_102429173 | 263 |
| 93 | 3300010882 | Ga0123354_10577726 | Ga0123354_105777261 | 263 |
| 94 | 3300042598 | Ga0466701_046038 | Ga0466701_046038_1063_1854 | 263 |
| 95 | 3300042615 | Ga0466711_018525 | Ga0466711_018525_1419_2210 | 263 |
| 96 | 3300042635 | Ga0466702_009442 | Ga0466702_009442_3727_4518 | 263 |
| 97 | iso_pr_bacteria | 2820789850 | 2820792836 | 263 |
| 98 | 3300005201 | Ga0072941_1286452 | Ga0072941_12864521 | 264 |
| 99 | 3300010167 | Ga0123353_10069440 | Ga0123353_100694403 | 264 |
| 100 | 3300042594 | Ga0466694_040621 | Ga0466694_040621_3309_4103 | 264 |
| 101 | 3300042609 | Ga0466722_090603 | Ga0466722_090603_141_935 | 264 |
| 102 | 3300042652 | Ga0466708_029408 | Ga0466708_029408_4317_5114 | 265 |
| 103 | 3300010167 | Ga0123353_10882702 | Ga0123353_108827021 | 266 |
| 104 | 3300010882 | Ga0123354_10180401 | Ga0123354_101804012 | 266 |
| 105 | 3300042597 | Ga0466699_330119 | Ga0466699_330119_1673_2473 | 266 |
| 106 | 3300042593 | Ga0466691_001648 | Ga0466691_001648_1605_2408 | 267 |
| 107 | 3300042636 | Ga0466703_146084 | Ga0466703_146084_2228_3031 | 267 |
| 108 | 3300042596 | Ga0466696_096298 | Ga0466696_096298_116_922 | 268 |
| 109 | 3300000062 | IMNBL1DRAFT_c0020236 | IMNBL1DRAFT_00202363 | 270 |
| 110 | 3300042612 | Ga0466705_228589 | Ga0466705_228589_2116_2928 | 270 |
| 111 | 3300042636 | Ga0466703_041043 | Ga0466703_041043_4826_5653 | 275 |
| 112 | 2225789004 | 2227519073 | 2228020534 | 278 |
| 113 | 3300042596 | Ga0466696_110381 | Ga0466696_110381_1314_2150 | 278 |
| 114 | 3300042648 | Ga0466709_209760 | Ga0466709_209760_12881_13717 | 278 |
| 115 | 3300042636 | Ga0466703_022682 | Ga0466703_022682_3461_4303 | 280 |
| 116 | 3300042612 | Ga0466705_168781 | Ga0466705_168781_5142_5990 | 282 |
| 117 | 3300042596 | Ga0466696_195640 | Ga0466696_195640_3740_4594 | 284 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF08843 | AbiEii | Nucleotidyl transferase AbiEii toxin, Type IV TA system | 30 | 239 | 0.83 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.91 | 0.93 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.