Protein Family IF05147
Metagenome
Isolate
186
Members
59
Samples
180
Scaffolds
142.74
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_124454|Ga0466696_124454_11288_11770
- Length
- 160 aa
- Sequence
- LTGKSKRTTIMTIQEIQQQIADEFSVFTEWLDKYAYLIELGKSLTPYDEKNRVEQNLIQGCQSRVWLNAELTDDGKLAFTADSDAIITKGIVSLLVRVFSGQTPQDIIAADVSFLDKIGLRENLSPTRANGLLSMVKQMKLYAVAFDAQKRNPQPVNSPN
Sample Types
Isolate
3.2%
Metagenome
96.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.4%
Kalotermitidae
24.1%
Unclassified
12.1%
Termopsidae
5.2%
Rhinotermitidae
5.2%
Blattidae
3.4%
Passalidae
3.4%
Armadillidiidae
1.7%
Hodotermitidae
1.7%
Formicidae
1.7%
Taxonomy
Archaea
1
Bacteria
177
Eukaryota
0
Viruses
1
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 4 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 5 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 6 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 7 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 8 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 11 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 12 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 13 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 14 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 18 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 23 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 24 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 25 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 26 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 27 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 28 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 33 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 38 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 42 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 43 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 44 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 45 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 46 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 47 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 48 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 49 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 50 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 51 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 52 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 53 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 54 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 55 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 56 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 57 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 58 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 59 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_197696 | 3300042611 | Bacteria | 22639 |
| 2 | Ga0466733_078603 | 3300042659 | Bacteria | 14665 |
| 3 | Ga0466733_194160 | 3300042659 | Bacteria | 1752 |
| 4 | Ga0123356_10062091 | 3300010049 | Bacteria | 3490 |
| 5 | Ga0123353_10051540 | 3300010167 | Bacteria | 6568 |
| 6 | Ga0123353_10251847 | 3300010167 | Bacteria | 2734 |
| 7 | Ga0466700_249634 | 3300042600 | Bacteria | 1468 |
| 8 | Ga0466707_233245 | 3300042601 | Bacteria | 2719 |
| 9 | Ga0466717_252053 | 3300042604 | Bacteria | 1084 |
| 10 | Ga0466716_133964 | 3300042605 | Bacteria | 5821 |
| 11 | Ga0160467_104767 | 3300012829 | Bacteria | 1845 |
| 12 | Ga0466657_390377 | 3300042582 | Bacteria | 1146 |
| 13 | Ga0466690_270057 | 3300042590 | Bacteria | 3283 |
| 14 | Ga0466695_005018 | 3300042595 | Bacteria | 3772 |
| 15 | Ga0466696_051840 | 3300042596 | Bacteria | 26856 |
| 16 | JGI24705J35276_12202141 | 3300002504 | Bacteria | 1631 |
| 17 | Ga0466710_060675 | 3300042613 | Bacteria | 5161 |
| 18 | Ga0466715_026465 | 3300042616 | Bacteria | 99999 |
| 19 | Ga0466723_180229 | 3300042618 | Bacteria | 19998 |
| 20 | Ga0466726_376057 | 3300042619 | Bacteria | 4503 |
| 21 | Ga0466726_424394 | 3300042619 | Bacteria | 1525 |
| 22 | Ga0466728_015945 | 3300042620 | Bacteria | 3595 |
| 23 | Ga0466728_130780 | 3300042620 | Bacteria | 9493 |
| 24 | Ga0466729_217256 | 3300042621 | Bacteria | 12485 |
| 25 | Ga0466704_543650 | 3300042643 | Bacteria | 22881 |
| 26 | Ga0466708_081429 | 3300042652 | Bacteria | 11682 |
| 27 | Ga0466708_289037 | 3300042652 | Bacteria | 4318 |
| 28 | Ga0466733_003427 | 3300042659 | Bacteria | 4336 |
| 29 | Ga0123356_10027617 | 3300010049 | Bacteria | 5318 |
| 30 | Ga0123356_10645268 | 3300010049 | Bacteria | 1226 |
| 31 | Ga0123353_10006523 | 3300010167 | Bacteria | 15545 |
| 32 | Ga0123353_10166326 | 3300010167 | Bacteria | 3505 |
| 33 | Ga0123353_10767826 | 3300010167 | Viruses | 1338 |
| 34 | Ga0123353_11216719 | 3300010167 | Bacteria | 987 |
| 35 | Ga0123353_12932946 | 3300010167 | Bacteria | 555 |
| 36 | Ga0123354_10393940 | 3300010882 | Bacteria | 1180 |
| 37 | Ga0466722_179951 | 3300042609 | Bacteria | 1465 |
| 38 | Ga0466692_102244 | 3300042591 | Bacteria | 27959 |
| 39 | IMNBL1DRAFT_c0001357 | 3300000062 | Bacteria | 18416 |
| 40 | IMNBL1DRAFT_c0011263 | 3300000062 | Bacteria | 4192 |
| 41 | Ga0466715_023151 | 3300042616 | Bacteria | 3388 |
| 42 | Ga0466723_250414 | 3300042618 | Bacteria | 18038 |
| 43 | Ga0466697_065449 | 3300042611 | Bacteria | 1648 |
| 44 | Ga0466705_220469 | 3300042612 | Unclassified | 1359 |
| 45 | Ga0466732_156352 | 3300042656 | Bacteria | 5352 |
| 46 | Ga0123355_10001369 | 3300009826 | Bacteria | 33944 |
| 47 | Ga0123356_13025322 | 3300010049 | Bacteria | 587 |
| 48 | Ga0123353_10351648 | 3300010167 | Bacteria | 2220 |
| 49 | Ga0123353_10746431 | 3300010167 | Bacteria | 1363 |
| 50 | Ga0123353_11354008 | 3300010167 | Bacteria | 919 |
| 51 | Ga0123353_12635477 | 3300010167 | Unclassified | 594 |
| 52 | Ga0466706_225176 | 3300042599 | Bacteria | 38857 |
| 53 | Ga0466707_000364 | 3300042601 | Bacteria | 1306 |
| 54 | Ga0466714_133436 | 3300042603 | Bacteria | 2205 |
| 55 | Ga0466716_437183 | 3300042605 | Bacteria | 31064 |
| 56 | Ga0466716_520514 | 3300042605 | Bacteria | 6887 |
| 57 | Ga0466698_002753 | 3300042610 | Bacteria | 2570 |
| 58 | Ga0466690_024191 | 3300042590 | Bacteria | 8374 |
| 59 | Ga0466690_090562 | 3300042590 | Bacteria | 8703 |
| 60 | 2227601850 | 2225789004 | Bacteria | 2330 |
| 61 | Ga0068305_10042196 | 3300005083 | Bacteria | 15988 |
| 62 | Ga0466715_173123 | 3300042616 | Bacteria | 2746 |
| 63 | Ga0466715_506549 | 3300042616 | Bacteria | 7737 |
| 64 | Ga0466723_138623 | 3300042618 | Bacteria | 14320 |
| 65 | Ga0466728_104727 | 3300042620 | Bacteria | 10439 |
| 66 | Ga0466731_012581 | 3300042622 | Bacteria | 1612 |
| 67 | Ga0466732_134431 | 3300042656 | Bacteria | 1014 |
| 68 | Ga0466733_021781 | 3300042659 | Bacteria | 2130 |
| 69 | Ga0123356_10051107 | 3300010049 | Bacteria | 3845 |
| 70 | Ga0123356_11405145 | 3300010049 | Bacteria | 858 |
| 71 | Ga0123353_10072870 | 3300010167 | Bacteria | 5520 |
| 72 | Ga0123353_10863347 | 3300010167 | Bacteria | 1238 |
| 73 | Ga0123354_10093161 | 3300010882 | Bacteria | 4143 |
| 74 | Ga0466701_099379 | 3300042598 | Bacteria | 1156 |
| 75 | Ga0466719_386651 | 3300042606 | Unclassified | 1691 |
| 76 | Ga0466698_045407 | 3300042610 | Bacteria | 1385 |
| 77 | Ga0466690_231717 | 3300042590 | Bacteria | 10279 |
| 78 | Ga0466690_418022 | 3300042590 | Bacteria | 18447 |
| 79 | Ga0466691_119991 | 3300042593 | Bacteria | 41422 |
| 80 | Ga0466696_022111 | 3300042596 | Bacteria | 3010 |
| 81 | Ga0466696_075613 | 3300042596 | Bacteria | 2562 |
| 82 | IMNBL1DRAFT_c0054762 | 3300000062 | Bacteria | 1234 |
| 83 | Ga0466712_320872 | 3300042614 | Bacteria | 1414 |
| 84 | Ga0466711_126881 | 3300042615 | Bacteria | 7656 |
| 85 | Ga0466718_112585 | 3300042617 | Bacteria | 2635 |
| 86 | Ga0466723_031620 | 3300042618 | Bacteria | 46972 |
| 87 | Ga0466726_447449 | 3300042619 | Bacteria | 3062 |
| 88 | Ga0466728_332643 | 3300042620 | Bacteria | 3872 |
| 89 | Ga0466704_445202 | 3300042643 | Bacteria | 2743 |
| 90 | Ga0466705_012668 | 3300042612 | Bacteria | 2906 |
| 91 | Ga0466732_190481 | 3300042656 | Bacteria | 1066 |
| 92 | Ga0466732_332718 | 3300042656 | Bacteria | 1819 |
| 93 | Ga0123353_10000053 | 3300010167 | Bacteria | 130089 |
| 94 | Ga0123354_10131627 | 3300010882 | Bacteria | 3156 |
| 95 | Ga0466716_061134 | 3300042605 | Bacteria | 7887 |
| 96 | Ga0466719_125870 | 3300042606 | Bacteria | 1967 |
| 97 | Ga0466722_250232 | 3300042609 | Bacteria | 10293 |
| 98 | Ga0466698_270872 | 3300042610 | Bacteria | 3164 |
| 99 | Ga0466696_124454 | 3300042596 | Bacteria | 17331 |
| 100 | Ga0466696_128027 | 3300042596 | Bacteria | 5216 |
| 101 | Ga0466696_427206 | 3300042596 | Bacteria | 4179 |
| 102 | IMNBL1DRAFT_c0009034 | 3300000062 | Bacteria | 4995 |
| 103 | Ga0072940_1158086 | 3300005200 | Bacteria | 955 |
| 104 | Ga0466729_114770 | 3300042621 | Bacteria | 12196 |
| 105 | Ga0466703_104748 | 3300042636 | Bacteria | 7412 |
| 106 | Ga0466709_127340 | 3300042648 | Bacteria | 4907 |
| 107 | Ga0466725_198449 | 3300042654 | Bacteria | 2353 |
| 108 | Ga0466705_043701 | 3300042612 | Bacteria | 1345 |
| 109 | Ga0466705_370133 | 3300042612 | Bacteria | 27217 |
| 110 | Ga0123353_10069440 | 3300010167 | Bacteria | 5660 |
| 111 | Ga0123353_10303281 | 3300010167 | Bacteria | 2436 |
| 112 | Ga0466706_024744 | 3300042599 | Bacteria | 35584 |
| 113 | Ga0466706_059465 | 3300042599 | Bacteria | 3553 |
| 114 | Ga0466706_211053 | 3300042599 | Bacteria | 122086 |
| 115 | Ga0466707_173327 | 3300042601 | Bacteria | 10833 |
| 116 | Ga0466714_027987 | 3300042603 | Bacteria | 18048 |
| 117 | Ga0466714_077188 | 3300042603 | Bacteria | 1742 |
| 118 | Ga0466719_244456 | 3300042606 | Bacteria | 1641 |
| 119 | Ga0466722_126917 | 3300042609 | Bacteria | 2073 |
| 120 | Ga0466657_199242 | 3300042582 | Bacteria | 2252 |
| 121 | Ga0466691_091910 | 3300042593 | Bacteria | 7343 |
| 122 | IMNBL1DRAFT_c0002486 | 3300000062 | Bacteria | 12788 |
| 123 | Ga0068302_10261506 | 3300005071 | Bacteria | 2602 |
| 124 | Ga0072940_1103344 | 3300005200 | Bacteria | 1477 |
| 125 | Ga0072941_1066306 | 3300005201 | Bacteria | 4462 |
| 126 | Ga0466712_092176 | 3300042614 | Bacteria | 3022 |
| 127 | Ga0466728_228281 | 3300042620 | Bacteria | 35456 |
| 128 | Ga0466727_274524 | 3300042655 | Bacteria | 16423 |
| 129 | Ga0466697_066086 | 3300042611 | Bacteria | 1060 |
| 130 | Ga0466732_394096 | 3300042656 | Bacteria | 12185 |
| 131 | Ga0466732_441659 | 3300042656 | Unclassified | 3235 |
| 132 | Ga0123356_10352020 | 3300010049 | Archaea | 1597 |
| 133 | Ga0123356_12625388 | 3300010049 | Bacteria | 631 |
| 134 | Ga0123354_10541655 | 3300010882 | Bacteria | 883 |
| 135 | Ga0466706_032042 | 3300042599 | Unclassified | 1415 |
| 136 | Ga0466706_128607 | 3300042599 | Bacteria | 6933 |
| 137 | Ga0466706_130352 | 3300042599 | Bacteria | 33832 |
| 138 | Ga0466706_255718 | 3300042599 | Bacteria | 9171 |
| 139 | Ga0466700_431232 | 3300042600 | Bacteria | 1616 |
| 140 | Ga0466713_065519 | 3300042602 | Bacteria | 19812 |
| 141 | Ga0466690_100806 | 3300042590 | Bacteria | 4964 |
| 142 | Ga0466690_247613 | 3300042590 | Bacteria | 6308 |
| 143 | Ga0466692_004094 | 3300042591 | Bacteria | 26840 |
| 144 | Ga0466691_032873 | 3300042593 | Bacteria | 12318 |
| 145 | JGI24702J35022_10000521 | 3300002462 | Bacteria | 23268 |
| 146 | JGI24696J40584_12802985 | 3300002834 | Bacteria | 873 |
| 147 | Ga0072941_1289540 | 3300005201 | Bacteria | 1768 |
| 148 | Ga0102734_1010619 | 3300007129 | Bacteria | 2614 |
| 149 | Ga0466710_369441 | 3300042613 | Bacteria | 1892 |
| 150 | Ga0466726_019615 | 3300042619 | Bacteria | 2684 |
| 151 | Ga0466729_075862 | 3300042621 | Bacteria | 5112 |
| 152 | Ga0466703_210632 | 3300042636 | Unclassified | 20532 |
| 153 | Ga0466708_005726 | 3300042652 | Bacteria | 11867 |
| 154 | Ga0466727_014180 | 3300042655 | Bacteria | 1931 |
| 155 | Ga0466733_006487 | 3300042659 | Bacteria | 1690 |
| 156 | Ga0466733_051789 | 3300042659 | Bacteria | 3525 |
| 157 | Ga0466733_167667 | 3300042659 | Bacteria | 1644 |
| 158 | Ga0123356_10728025 | 3300010049 | Bacteria | 1162 |
| 159 | Ga0123356_11590634 | 3300010049 | Bacteria | 809 |
| 160 | Ga0123356_12792473 | 3300010049 | Bacteria | 611 |
| 161 | Ga0466713_063972 | 3300042602 | Bacteria | 1410 |
| 162 | Ga0466714_047059 | 3300042603 | Bacteria | 5742 |
| 163 | Ga0466714_098344 | 3300042603 | Bacteria | 4380 |
| 164 | Ga0466717_103287 | 3300042604 | Bacteria | 1232 |
| 165 | Ga0466719_572480 | 3300042606 | Bacteria | 3638 |
| 166 | Ga0466657_068092 | 3300042582 | Bacteria | 157899 |
| 167 | Ga0466691_124547 | 3300042593 | Bacteria | 6182 |
| 168 | Ga0466699_400731 | 3300042597 | Bacteria | 1814 |
| 169 | IMNBL1DRAFT_c0007092 | 3300000062 | Bacteria | 5963 |
| 170 | JGI24702J35022_10038705 | 3300002462 | Bacteria | 2546 |
| 171 | JGI24705J35276_12222574 | 3300002504 | Unclassified | 2432 |
| 172 | JGI24705J35276_12236276 | 3300002504 | Bacteria | 7763 |
| 173 | Ga0072940_1158085 | 3300005200 | Bacteria | 1497 |
| 174 | Ga0466715_117071 | 3300042616 | Bacteria | 2782 |
| 175 | Ga0466718_047477 | 3300042617 | Bacteria | 1670 |
| 176 | Ga0466726_055493 | 3300042619 | Bacteria | 2775 |
| 177 | Ga0466729_094959 | 3300042621 | Bacteria | 7754 |
| 178 | Ga0466729_099720 | 3300042621 | Bacteria | 12798 |
| 179 | Ga0466704_062076 | 3300042643 | Bacteria | 6235 |
| 180 | Ga0466708_264419 | 3300042652 | Bacteria | 49465 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02657 | SufE | Fe-S metabolism associated domain | 22 | 140 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.