Protein Family IF05145

Metagenome Isolate
216 Members
68 Samples
193 Scaffolds
419.65 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_117566|Ga0466696_117566_4151_5563
Length
470 aa
Sequence
MRRKTGKKQRQEPRGSSRRFSIASFKAGRPAWLMARVLKPDRLFEVRCTMKKVVITGMGIISPIGNSIADFENSLKAGKSGIGYITQFDTTDFDVKIAGEVKNFDPSLWMDKKDARKMARFTQFAVAAASQALEQAGLLSDGEDGRRRLARDAEKTGVVLGNGIGGFEIVSESFRKLFGQGPRRMLPLTIPLMIGNEAAGAISMLFGSKGPAFTQVTACASGTDALGQALDLVRAGRSDVVIAGGTEACIVPFGIGGFQMLKTLSTKRNNEPEKASRPFDADRDGFVIGEAAGVIVIESEEHALARGAAILAEFAGYGASADAYHITSPDPSGEGGGRAIKLALADAGLAPEEVQYYNAHGTSTEINDPTETKMIKYAFGDHAYKMKVSSVKSMTGHCVAGSGGIEAVASVLAILRGFYPPTINLDHPDPECDLDYVPNTAQYGEISVAVSGSLGFGGHNGVVVFKKRGA

📊 Sample Types

Isolate 10.7%
Metagenome 89.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.3%
Unclassified 27.7%
Kalotermitidae 21.5%
Rhinotermitidae 6.2%
Termopsidae 4.6%
Elmidae 3.1%
Hodotermitidae 1.5%
Noctuidae 1.5%
Blaberidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 211
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
2 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
3 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
4 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
5 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
6 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
7 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
8 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
9 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
10 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
11 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
12 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
13 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
14 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
15 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
16 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
17 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
18 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
19 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
20 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
21 2820721785 Unclassified Fibrobacteres Lab288P1bin58 Isolate Unclassified
22 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
23 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
24 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
25 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
26 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
27 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
28 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
29 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
30 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
31 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
32 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
33 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
34 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
35 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
36 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
37 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
38 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
39 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
40 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
41 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
42 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
46 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
47 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
48 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
49 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
50 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
51 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
52 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
53 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
54 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
55 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
56 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
57 2772190975 Treponema sp. RmG30 Isolate Blaberidae
58 2778260940 Unclassified Fibrobacteres Mp193P3bin36 Isolate Unclassified
59 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
60 3006667155 Streptomyces sp. SID9727 Isolate
61 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
62 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
63 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
64 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
65 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
66 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
67 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
68 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_302806 3300042612 Bacteria 6104
2 JGI24698J34947_10002253 3300002449 Bacteria 10330
3 JGI24695J34938_10000054 3300002450 Bacteria 90526
4 JGI24695J34938_10015775 3300002450 Bacteria 3866
5 Ga0466712_046372 3300042614 Bacteria 8790
6 Ga0466712_174035 3300042614 Bacteria 18446
7 Ga0466712_232623 3300042614 Bacteria 24742
8 Ga0466711_109279 3300042615 Bacteria 19924
9 Ga0466711_165956 3300042615 Bacteria 10532
10 Ga0466711_241704 3300042615 Bacteria 15416
11 Ga0466715_234140 3300042616 Bacteria 25168
12 Ga0466723_346282 3300042618 Bacteria 2216
13 Ga0466726_178845 3300042619 Bacteria 2522
14 Ga0466728_052009 3300042620 Bacteria 29279
15 Ga0466703_095090 3300042636 Bacteria 24169
16 Ga0466703_140435 3300042636 Bacteria 3950
17 Ga0466704_247183 3300042643 Bacteria 1978
18 Ga0466709_213068 3300042648 Bacteria 27541
19 Ga0466709_309844 3300042648 Bacteria 4545
20 Ga0466708_010598 3300042652 Bacteria 24627
21 Ga0466708_172099 3300042652 Bacteria 12278
22 Ga0466727_008737 3300042655 Bacteria 4003
23 Ga0466706_202148 3300042599 Bacteria 1514
24 Ga0466716_243612 3300042605 Bacteria 2882
25 Ga0466719_491059 3300042606 Bacteria 3928
26 Ga0466722_150459 3300042609 Bacteria 3128
27 Ga0466722_183400 3300042609 Bacteria 9904
28 Ga0415639_062210 3300038395 Bacteria 10116
29 Ga0466690_036233 3300042590 Bacteria 42451
30 Ga0466693_334370 3300042592 Bacteria 5446
31 Ga0466691_002246 3300042593 Bacteria 7226
32 Ga0466695_159245 3300042595 Bacteria 2797
33 Ga0466696_026925 3300042596 Bacteria 3843
34 JGI24698J34947_10004592 3300002449 Bacteria 7526
35 Ga0123356_10000647 3300010049 Bacteria 38345
36 Ga0123353_10011959 3300010167 Bacteria 12280
37 Ga0466712_034908 3300042614 Unclassified 2445
38 Ga0466715_354323 3300042616 Bacteria 2500
39 Ga0466718_063670 3300042617 Bacteria 6259
40 Ga0466728_082151 3300042620 Bacteria 22320
41 Ga0466703_021465 3300042636 Bacteria 13133
42 Ga0466703_021914 3300042636 Bacteria 11318
43 Ga0466708_029443 3300042652 Bacteria 7255
44 Ga0466708_431515 3300042652 Bacteria 25678
45 Ga0466706_220146 3300042599 Bacteria 3092
46 Ga0466706_282010 3300042599 Bacteria 3492
47 Ga0466713_086638 3300042602 Bacteria 6169
48 Ga0466716_032607 3300042605 Bacteria 13485
49 Ga0466716_440275 3300042605 Bacteria 11230
50 Ga0466719_028469 3300042606 Bacteria 32780
51 Ga0466698_037769 3300042610 Bacteria 1902
52 Ga0466692_133586 3300042591 Bacteria 8174
53 Ga0466691_024281 3300042593 Bacteria 18067
54 Ga0466696_117566 3300042596 Bacteria 6011
55 Ga0466696_436012 3300042596 Bacteria 28892
56 AustNasuHG_c1006544 3300000089 Bacteria 4150
57 JGI24698J34947_10011041 3300002449 Bacteria 4955
58 JGI24698J34947_10023756 3300002449 Bacteria 3278
59 JGI24695J34938_10001308 3300002450 Bacteria 21729
60 JGI24695J34938_10001456 3300002450 Bacteria 20021
61 JGI24695J34938_10007893 3300002450 Bacteria 6156
62 Ga0072941_1001094 3300005201 Bacteria 56271
63 Ga0072941_1001417 3300005201 Bacteria 15868
64 Ga0123353_10281379 3300010167 Bacteria 2554
65 Ga0466728_311321 3300042620 Bacteria 4383
66 Ga0466734_022359 3300042623 Bacteria 2792
67 Ga0466703_205642 3300042636 Bacteria 23905
68 Ga0466708_199326 3300042652 Bacteria 19137
69 Ga0466727_230491 3300042655 Bacteria 44965
70 Ga0466700_490873 3300042600 Bacteria 1905
71 Ga0466716_017164 3300042605 Bacteria 4473
72 Ga0466716_358355 3300042605 Bacteria 6932
73 Ga0466716_412339 3300042605 Bacteria 2644
74 Ga0466690_350377 3300042590 Bacteria 16475
75 Ga0466691_144242 3300042593 Bacteria 6807
76 Ga0466696_451184 3300042596 Bacteria 9729
77 AustNasuHG_c1002565 3300000089 Bacteria 6556
78 Ga0123357_10108018 3300009784 Bacteria 3561
79 Ga0123353_10064352 3300010167 Bacteria 5885
80 Ga0466715_272677 3300042616 Bacteria 29328
81 Ga0466726_191133 3300042619 Bacteria 1800
82 Ga0466726_277808 3300042619 Bacteria 7468
83 Ga0466728_134017 3300042620 Bacteria 5815
84 Ga0466729_318283 3300042621 Bacteria 3713
85 Ga0466703_057069 3300042636 Bacteria 15052
86 Ga0466703_097458 3300042636 Bacteria 17144
87 Ga0466703_180625 3300042636 Bacteria 11870
88 Ga0466704_113543 3300042643 Bacteria 47006
89 Ga0466704_218768 3300042643 Bacteria 93221
90 Ga0466708_221127 3300042652 Bacteria 22571
91 Ga0466713_062921 3300042602 Bacteria 4143
92 Ga0466719_243057 3300042606 Bacteria 7358
93 Ga0466720_165176 3300042607 Bacteria 5153
94 Ga0466722_027912 3300042609 Bacteria 4986
95 Ga0466691_151842 3300042593 Bacteria 33363
96 Ga0466691_156730 3300042593 Bacteria 16286
97 Ga0466696_083696 3300042596 Bacteria 32412
98 Ga0466705_300135 3300042612 Bacteria 2414
99 Ga0466705_322251 3300042612 Bacteria 71824
100 AustNasuHG_c1004927 3300000089 Bacteria 4781
101 JGI24698J34947_10031072 3300002449 Bacteria 2814
102 Ga0123355_10357819 3300009826 Bacteria 1926
103 Ga0123353_10006784 3300010167 Bacteria 15345
104 Ga0466705_432203 3300042612 Bacteria 9885
105 Ga0466712_105477 3300042614 Unclassified 3647
106 Ga0466715_091172 3300042616 Bacteria 15982
107 Ga0466715_449231 3300042616 Bacteria 13036
108 Ga0466703_081169 3300042636 Unclassified 12346
109 Ga0466709_336760 3300042648 Bacteria 24317
110 Ga0466727_212581 3300042655 Bacteria 2373
111 Ga0466713_149704 3300042602 Bacteria 6551
112 Ga0466714_047930 3300042603 Bacteria 3169
113 Ga0466716_095614 3300042605 Bacteria 5479
114 Ga0466716_099092 3300042605 Bacteria 24869
115 Ga0466716_317194 3300042605 Bacteria 2000
116 Ga0466719_181684 3300042606 Bacteria 21794
117 Ga0466720_098651 3300042607 Bacteria 30361
118 Ga0466722_101842 3300042609 Bacteria 5242
119 Ga0466722_201187 3300042609 Bacteria 3141
120 Ga0264413_142419 3300024493 Unclassified 10505
121 Ga0415639_008352 3300038395 Bacteria 5892
122 Ga0415639_025111 3300038395 Bacteria 13624
123 Ga0466690_252115 3300042590 Bacteria 2002
124 Ga0466690_415509 3300042590 Bacteria 2223
125 Ga0466692_067810 3300042591 Bacteria 6352
126 Ga0466692_146628 3300042591 Bacteria 8991
127 Ga0466691_012248 3300042593 Bacteria 11427
128 Ga0466694_176633 3300042594 Bacteria 15811
129 Ga0466696_034586 3300042596 Bacteria 39154
130 Ga0466696_097669 3300042596 Bacteria 3175
131 Ga0466705_150149 3300042612 Bacteria 2761
132 AustNasuHG_c1003116 3300000089 Bacteria 5978
133 Ga0123357_10008026 3300009784 Bacteria 13134
134 Ga0123355_10008062 3300009826 Bacteria 15888
135 Ga0123353_10352525 3300010167 Bacteria 2216
136 Ga0466711_296283 3300042615 Bacteria 4168
137 Ga0466723_156206 3300042618 Bacteria 10058
138 Ga0466723_176242 3300042618 Bacteria 78804
139 Ga0466723_261184 3300042618 Bacteria 24963
140 Ga0466726_355114 3300042619 Bacteria 22564
141 Ga0466728_279811 3300042620 Bacteria 2428
142 Ga0466704_449099 3300042643 Bacteria 67975
143 Ga0466704_513260 3300042643 Bacteria 7580
144 Ga0466709_100287 3300042648 Bacteria 7532
145 Ga0466708_216654 3300042652 Bacteria 1713
146 Ga0466727_086830 3300042655 Bacteria 5055
147 Ga0466727_332188 3300042655 Bacteria 29400
148 Ga0466713_040738 3300042602 Bacteria 2532
149 Ga0466713_089291 3300042602 Unclassified 2159
150 Ga0466716_418030 3300042605 Bacteria 5777
151 Ga0466719_089876 3300042606 Bacteria 10186
152 Ga0466720_002997 3300042607 Bacteria 2390
153 Ga0466698_278451 3300042610 Bacteria 35706
154 Ga0466690_251136 3300042590 Bacteria 7913
155 Ga0466692_019068 3300042591 Bacteria 26671
156 Ga0466691_175199 3300042593 Bacteria 27229
157 Ga0123355_10028033 3300009826 Bacteria 9103
158 Ga0123353_10151190 3300010167 Bacteria 3706
159 Ga0123354_10091490 3300010882 Bacteria 4202
160 Ga0466711_094319 3300042615 Bacteria 9155
161 Ga0466723_009721 3300042618 Bacteria 10320
162 Ga0466723_041176 3300042618 Bacteria 11013
163 Ga0466726_058473 3300042619 Bacteria 1914
164 Ga0466731_329732 3300042622 Bacteria 8976
165 Ga0466704_063388 3300042643 Bacteria 28208
166 Ga0466704_381979 3300042643 Bacteria 10325
167 Ga0466708_019663 3300042652 Bacteria 17827
168 Ga0466708_076359 3300042652 Bacteria 9547
169 Ga0466719_091213 3300042606 Bacteria 5140
170 Ga0466691_079109 3300042593 Bacteria 25486
171 Ga0466694_155826 3300042594 Bacteria 14964
172 Ga0466695_316094 3300042595 Bacteria 79149
173 Ga0466705_016129 3300042612 Bacteria 11821
174 JGI24698J34947_10011859 3300002449 Bacteria 4786
175 Ga0123356_10026572 3300010049 Bacteria 5431
176 Ga0123353_10471761 3300010167 Bacteria 1840
177 Ga0466711_335759 3300042615 Bacteria 14176
178 Ga0466715_134289 3300042616 Bacteria 11722
179 Ga0466726_026833 3300042619 Bacteria 7644
180 Ga0466735_086184 3300042624 Bacteria 4694
181 Ga0466702_241968 3300042635 Bacteria 34411
182 Ga0466703_022875 3300042636 Bacteria 10697
183 Ga0466704_122187 3300042643 Bacteria 4831
184 Ga0466704_147023 3300042643 Bacteria 8939
185 Ga0466709_407166 3300042648 Bacteria 5100
186 Ga0466708_267194 3300042652 Bacteria 2839
187 Ga0466722_100606 3300042609 Bacteria 10949
188 Ga0466722_122220 3300042609 Bacteria 4754
189 Ga0456237_0001211 3300041968 Bacteria 4075
190 Ga0466691_080571 3300042593 Bacteria 6481
191 Ga0466695_406800 3300042595 Bacteria 2366
192 Ga0466696_080359 3300042596 Bacteria 9627
193 Ga0466696_454869 3300042596 Bacteria 2230

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042615 Ga0466711_335759 Ga0466711_335759_10487_11743 391
2 3300042605 Ga0466716_243612 Ga0466716_243612_320_1501 393
3 3300042652 Ga0466708_431515 Ga0466708_431515_6535_7803 393
4 3300042605 Ga0466716_358355 Ga0466716_358355_3516_4790 396
5 3300042616 Ga0466715_234140 Ga0466715_234140_7652_8923 397
6 3300042616 Ga0466715_091172 Ga0466715_091172_11540_12745 401
7 3300042652 Ga0466708_010598 Ga0466708_010598_7072_8283 403
8 3300042596 Ga0466696_080359 Ga0466696_080359_1245_2510 404
9 3300042605 Ga0466716_017164 Ga0466716_017164_1689_2957 404
10 3300042615 Ga0466711_094319 Ga0466711_094319_234_1496 404
11 iso_pr_bacteria 2528768159 2529056046 404
12 3300042605 Ga0466716_032607 Ga0466716_032607_8379_9650 405
13 3300042648 Ga0466709_213068 Ga0466709_213068_16835_18106 405
14 iso_pr_bacteria 2864870719 2864870771 406
15 iso_pr_bacteria 2864960361 2864960413 406
16 3300042609 Ga0466722_183400 Ga0466722_183400_5268_6536 407
17 3300042621 Ga0466729_318283 Ga0466729_318283_1909_3168 407
18 3300042620 Ga0466728_279811 Ga0466728_279811_934_2202 408
19 3300042652 Ga0466708_076359 Ga0466708_076359_4310_5536 408
20 3300042615 Ga0466711_165956 Ga0466711_165956_7119_8390 409
21 3300042620 Ga0466728_311321 Ga0466728_311321_1549_2778 409
22 3300042652 Ga0466708_267194 Ga0466708_267194_420_1649 409
23 3300042655 Ga0466727_212581 Ga0466727_212581_747_1979 410
24 3300042606 Ga0466719_028469 Ga0466719_028469_18583_19857 411
25 3300042612 Ga0466705_016129 Ga0466705_016129_3039_4274 411
26 3300042612 Ga0466705_150149 Ga0466705_150149_1257_2603 411
27 3300024493 Ga0264413_142419 Ga0264413_1424192 412
28 3300042593 Ga0466691_002246 Ga0466691_002246_1962_3200 412
29 3300042602 Ga0466713_149704 Ga0466713_149704_4904_6142 412
30 3300042605 Ga0466716_317194 Ga0466716_317194_380_1618 412
31 3300042605 Ga0466716_412339 Ga0466716_412339_1394_2632 412
32 3300042610 Ga0466698_278451 Ga0466698_278451_2745_3983 412
33 3300042614 Ga0466712_105477 Ga0466712_105477_1534_2772 412
34 3300042636 Ga0466703_021914 Ga0466703_021914_7553_8791 412
35 3300042643 Ga0466704_247183 Ga0466704_247183_275_1513 412
36 iso_pr_bacteria 2778260940 2778355849 412
37 3300042591 Ga0466692_133586 Ga0466692_133586_1067_2308 413
38 3300042596 Ga0466696_026925 Ga0466696_026925_1333_2601 413
39 3300042603 Ga0466714_047930 Ga0466714_047930_1085_2326 413
40 3300042615 Ga0466711_241704 Ga0466711_241704_10273_11514 413
41 iso_pr_bacteria 2820721785 2820723410 413
42 3300010167 Ga0123353_10281379 Ga0123353_102813792 414
43 3300010167 Ga0123353_10471761 Ga0123353_104717611 414
44 3300042594 Ga0466694_155826 Ga0466694_155826_5357_6601 414
45 3300042594 Ga0466694_176633 Ga0466694_176633_10441_11685 414
46 3300042595 Ga0466695_406800 Ga0466695_406800_504_1748 414
47 3300042599 Ga0466706_282010 Ga0466706_282010_71_1315 414
48 3300042616 Ga0466715_272677 Ga0466715_272677_16387_17631 414
49 iso_pr_bacteria 2551306396 2552921842 414
50 iso_pr_bacteria 2983866074 2983870868 414
51 3300000089 AustNasuHG_c1003116 AustNasuHG_10031164 415
52 3300002449 JGI24698J34947_10011041 JGI24698J34947_100110411 415
53 3300009826 Ga0123355_10008062 Ga0123355_100080624 415
54 3300009826 Ga0123355_10028033 Ga0123355_100280336 415
55 3300010167 Ga0123353_10006784 Ga0123353_100067843 415
56 3300010167 Ga0123353_10151190 Ga0123353_101511902 415
57 3300042591 Ga0466692_067810 Ga0466692_067810_742_2010 415
58 3300042596 Ga0466696_097669 Ga0466696_097669_1640_2887 415
59 3300042616 Ga0466715_354323 Ga0466715_354323_691_1938 415
60 3300042648 Ga0466709_100287 Ga0466709_100287_2387_3634 415
61 3300042623 Ga0466734_022359 Ga0466734_022359_240_1490 416
62 3300042655 Ga0466727_086830 Ga0466727_086830_1171_2451 416
63 3300042606 Ga0466719_089876 Ga0466719_089876_2382_3635 417
64 3300042636 Ga0466703_022875 Ga0466703_022875_7406_8659 417
65 3300042636 Ga0466703_097458 Ga0466703_097458_4727_5980 417
66 3300042648 Ga0466709_336760 Ga0466709_336760_22261_23544 417
67 3300042652 Ga0466708_199326 Ga0466708_199326_11835_13088 417
68 iso_pr_bacteria 3006667155 3006668674 418
69 3300042593 Ga0466691_156730 Ga0466691_156730_5222_6481 419
70 3300042602 Ga0466713_062921 Ga0466713_062921_2005_3264 419
71 3300042602 Ga0466713_086638 Ga0466713_086638_3448_4707 419
72 3300042606 Ga0466719_181684 Ga0466719_181684_2703_3962 419
73 3300042616 Ga0466715_134289 Ga0466715_134289_4618_5877 419
74 3300042616 Ga0466715_449231 Ga0466715_449231_5067_6326 419
75 3300042643 Ga0466704_449099 Ga0466704_449099_52229_53488 419
76 3300042652 Ga0466708_029443 Ga0466708_029443_2921_4180 419
77 3300042655 Ga0466727_332188 Ga0466727_332188_14812_16071 419
78 3300042590 Ga0466690_036233 Ga0466690_036233_9163_10425 420
79 3300042590 Ga0466690_350377 Ga0466690_350377_14899_16161 420
80 3300042593 Ga0466691_079109 Ga0466691_079109_23412_24674 420
81 3300042606 Ga0466719_091213 Ga0466719_091213_3256_4518 420
82 3300042619 Ga0466726_058473 Ga0466726_058473_81_1343 420
83 3300042619 Ga0466726_355114 Ga0466726_355114_18089_19351 420
84 3300042636 Ga0466703_081169 Ga0466703_081169_2553_3815 420
85 3300042636 Ga0466703_095090 Ga0466703_095090_351_1613 420
86 3300042636 Ga0466703_180625 Ga0466703_180625_290_1552 420
87 3300042643 Ga0466704_218768 Ga0466704_218768_23337_24599 420
88 3300042655 Ga0466727_230491 Ga0466727_230491_4626_5888 420
89 iso_pr_bacteria 2781125686 2781418776 420
90 3300005201 Ga0072941_1001094 Ga0072941_100109449 421
91 3300010882 Ga0123354_10091490 Ga0123354_100914904 421
92 3300038395 Ga0415639_062210 Ga0415639_062210_6023_7288 421
93 3300041968 Ga0456237_0001211 Ga0456237_0001211_985_2250 421
94 3300042591 Ga0466692_019068 Ga0466692_019068_10179_11444 421
95 3300042593 Ga0466691_024281 Ga0466691_024281_7260_8525 421
96 3300042593 Ga0466691_144242 Ga0466691_144242_5119_6384 421
97 3300042596 Ga0466696_083696 Ga0466696_083696_14131_15396 421
98 3300042596 Ga0466696_451184 Ga0466696_451184_6746_8011 421
99 3300042605 Ga0466716_095614 Ga0466716_095614_156_1457 421
100 3300042605 Ga0466716_418030 Ga0466716_418030_429_1694 421
101 3300042607 Ga0466720_165176 Ga0466720_165176_1411_2676 421
102 3300042609 Ga0466722_122220 Ga0466722_122220_1019_2284 421
103 3300042612 Ga0466705_300135 Ga0466705_300135_925_2190 421
104 3300042618 Ga0466723_009721 Ga0466723_009721_1376_2641 421
105 3300042624 Ga0466735_086184 Ga0466735_086184_2359_3624 421
106 3300042636 Ga0466703_057069 Ga0466703_057069_6591_7856 421
107 3300042643 Ga0466704_063388 Ga0466704_063388_11279_12544 421
108 3300042648 Ga0466709_309844 Ga0466709_309844_1636_2901 421
109 iso_pr_bacteria 2772190975 2773724048 421
110 iso_pr_bacteria 2781125666 2781345736 421
111 3300009784 Ga0123357_10008026 Ga0123357_100080269 422
112 3300009784 Ga0123357_10108018 Ga0123357_101080184 422
113 3300010167 Ga0123353_10011959 Ga0123353_1001195910 422
114 3300010167 Ga0123353_10064352 Ga0123353_100643529 422
115 3300042591 Ga0466692_146628 Ga0466692_146628_3871_5139 422
116 3300042592 Ga0466693_334370 Ga0466693_334370_4108_5376 422
117 3300042596 Ga0466696_436012 Ga0466696_436012_26592_27860 422
118 3300042600 Ga0466700_490873 Ga0466700_490873_110_1378 422
119 3300042605 Ga0466716_099092 Ga0466716_099092_10645_11913 422
120 3300042605 Ga0466716_440275 Ga0466716_440275_1677_2945 422
121 3300042606 Ga0466719_491059 Ga0466719_491059_1682_2950 422
122 3300042609 Ga0466722_027912 Ga0466722_027912_3438_4706 422
123 3300042609 Ga0466722_101842 Ga0466722_101842_2096_3364 422
124 3300042609 Ga0466722_201187 Ga0466722_201187_540_1808 422
125 3300042614 Ga0466712_232623 Ga0466712_232623_388_1656 422
126 3300042617 Ga0466718_063670 Ga0466718_063670_1524_2792 422
127 3300042619 Ga0466726_026833 Ga0466726_026833_2110_3378 422
128 3300042619 Ga0466726_277808 Ga0466726_277808_4235_5503 422
129 3300042620 Ga0466728_052009 Ga0466728_052009_8485_9753 422
130 3300042643 Ga0466704_113543 Ga0466704_113543_12118_13386 422
131 3300042652 Ga0466708_172099 Ga0466708_172099_948_2216 422
132 iso_pr_bacteria 2781125631 2781268924 422
133 iso_pr_bacteria 2781125632 2781271755 422
134 iso_pr_bacteria 2781125661 2781333066 422
135 iso_pr_bacteria 2781125664 2781339339 422
136 iso_pr_bacteria 2781125692 2781432176 422
137 3300000089 AustNasuHG_c1002565 AustNasuHG_10025659 423
138 3300000089 AustNasuHG_c1004927 AustNasuHG_10049272 423
139 3300002449 JGI24698J34947_10011859 JGI24698J34947_100118593 423
140 3300002449 JGI24698J34947_10031072 JGI24698J34947_100310722 423
141 3300002450 JGI24695J34938_10000054 JGI24695J34938_1000005428 423
142 3300002450 JGI24695J34938_10007893 JGI24695J34938_100078935 423
143 3300002450 JGI24695J34938_10015775 JGI24695J34938_100157753 423
144 3300010049 Ga0123356_10000647 Ga0123356_1000064717 423
145 3300038395 Ga0415639_025111 Ga0415639_025111_4809_6080 423
146 3300042590 Ga0466690_251136 Ga0466690_251136_5642_6913 423
147 3300042590 Ga0466690_252115 Ga0466690_252115_158_1429 423
148 3300042590 Ga0466690_415509 Ga0466690_415509_638_1909 423
149 3300042593 Ga0466691_151842 Ga0466691_151842_16803_18074 423
150 3300042593 Ga0466691_175199 Ga0466691_175199_3231_4502 423
151 3300042595 Ga0466695_316094 Ga0466695_316094_40068_41339 423
152 3300042612 Ga0466705_322251 Ga0466705_322251_32725_33996 423
153 3300042615 Ga0466711_109279 Ga0466711_109279_6481_7752 423
154 3300042618 Ga0466723_041176 Ga0466723_041176_3604_4875 423
155 3300042618 Ga0466723_261184 Ga0466723_261184_14976_16247 423
156 3300042618 Ga0466723_346282 Ga0466723_346282_339_1610 423
157 3300042619 Ga0466726_191133 Ga0466726_191133_188_1459 423
158 3300042620 Ga0466728_082151 Ga0466728_082151_792_2063 423
159 3300042622 Ga0466731_329732 Ga0466731_329732_5861_7132 423
160 3300042643 Ga0466704_122187 Ga0466704_122187_2945_4216 423
161 3300042643 Ga0466704_147023 Ga0466704_147023_6687_7958 423
162 iso_pr_bacteria 2781125632 2781271846 423
163 iso_pr_bacteria 2781125634 2781273731 423
164 iso_pr_bacteria 2781125653 2781313253 423
165 iso_pr_bacteria 2781125655 2781318597 423
166 iso_pr_bacteria 2781125683 2781410788 423
167 3300002449 JGI24698J34947_10002253 JGI24698J34947_100022533 424
168 3300002449 JGI24698J34947_10004592 JGI24698J34947_100045926 424
169 3300002449 JGI24698J34947_10023756 JGI24698J34947_100237563 424
170 3300002450 JGI24695J34938_10001308 JGI24695J34938_1000130820 424
171 3300002450 JGI24695J34938_10001456 JGI24695J34938_1000145611 424
172 3300005201 Ga0072941_1001417 Ga0072941_10014179 424
173 3300009826 Ga0123355_10357819 Ga0123355_103578193 424
174 3300010049 Ga0123356_10026572 Ga0123356_100265722 424
175 3300042593 Ga0466691_080571 Ga0466691_080571_2342_3616 424
176 3300042599 Ga0466706_202148 Ga0466706_202148_66_1340 424
177 3300042602 Ga0466713_040738 Ga0466713_040738_142_1416 424
178 3300042602 Ga0466713_089291 Ga0466713_089291_140_1414 424
179 3300042610 Ga0466698_037769 Ga0466698_037769_611_1885 424
180 3300042612 Ga0466705_302806 Ga0466705_302806_1338_2612 424
181 3300042614 Ga0466712_034908 Ga0466712_034908_270_1544 424
182 3300042614 Ga0466712_174035 Ga0466712_174035_45_1319 424
183 3300042635 Ga0466702_241968 Ga0466702_241968_18998_20272 424
184 3300042636 Ga0466703_021465 Ga0466703_021465_7317_8591 424
185 3300042648 Ga0466709_407166 Ga0466709_407166_3193_4467 424
186 3300000089 AustNasuHG_c1006544 AustNasuHG_10065442 425
187 3300038395 Ga0415639_008352 Ga0415639_008352_1614_2891 425
188 3300042593 Ga0466691_012248 Ga0466691_012248_4235_5512 425
189 3300042599 Ga0466706_220146 Ga0466706_220146_761_2038 425
190 3300042606 Ga0466719_243057 Ga0466719_243057_971_2248 425
191 3300042615 Ga0466711_296283 Ga0466711_296283_1300_2577 425
192 3300042636 Ga0466703_140435 Ga0466703_140435_619_1896 425
193 3300042643 Ga0466704_513260 Ga0466704_513260_2852_4129 425
194 3300010167 Ga0123353_10352525 Ga0123353_103525252 426
195 3300042596 Ga0466696_454869 Ga0466696_454869_285_1565 426
196 3300042618 Ga0466723_176242 Ga0466723_176242_42442_43722 426
197 3300042619 Ga0466726_178845 Ga0466726_178845_43_1323 426
198 3300042652 Ga0466708_019663 Ga0466708_019663_15589_16869 426
199 iso_pr_bacteria 650716099 650878293 426
200 3300042609 Ga0466722_100606 Ga0466722_100606_2663_3946 427
201 3300042614 Ga0466712_046372 Ga0466712_046372_4239_5522 427
202 3300042652 Ga0466708_216654 Ga0466708_216654_125_1408 427
203 3300042609 Ga0466722_150459 Ga0466722_150459_769_2055 428
204 3300042612 Ga0466705_432203 Ga0466705_432203_7440_8726 428
205 3300042620 Ga0466728_134017 Ga0466728_134017_3842_5128 428
206 3300042636 Ga0466703_205642 Ga0466703_205642_7320_8606 428
207 3300042643 Ga0466704_381979 Ga0466704_381979_6539_7825 428
208 3300042595 Ga0466695_159245 Ga0466695_159245_1267_2556 429
209 3300042607 Ga0466720_002997 Ga0466720_002997_976_2265 429
210 3300042652 Ga0466708_221127 Ga0466708_221127_9853_11145 430
211 3300042607 Ga0466720_098651 Ga0466720_098651_24937_26232 431
212 3300042655 Ga0466727_008737 Ga0466727_008737_742_2037 431
213 iso_pr_bacteria 2781125687 2781421246 443
214 3300042596 Ga0466696_034586 Ga0466696_034586_30024_31406 460
215 3300042618 Ga0466723_156206 Ga0466723_156206_6808_8208 466
216 3300042596 Ga0466696_117566 Ga0466696_117566_4151_5563 470

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 311 425 0.97
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 51 303 0.93

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.