Protein Family IF05133
Metagenome
Isolate
119
Members
43
Samples
117
Scaffolds
154.45
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_094981|Ga0466696_094981_228_788
- Length
- 186 aa
- Sequence
- MRGKHIKIELSEEARNELEKFTRTGKHSDKLVTRAKLLHELDEAGGRKPLTQAKIAEKIGVDRRTVNDVKKAFLAADSAAVFLQRKKRRTPPVQPKITGEVEAHSIALACGPVPEGCAQWSVRLLADKSVELNYIDSISFKSVQRLLKKHNLNPTGIDKHEGERVGGWDTVVSREEYEQIFENRPA
Sample Types
Isolate
1.7%
Metagenome
98.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
73.8%
Kalotermitidae
19.0%
Unclassified
4.8%
Rhinotermitidae
2.4%
Taxonomy
Archaea
10
Bacteria
90
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 2 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 3 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 4 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 5 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 6 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 7 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 8 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 15 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 16 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 17 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 18 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 27 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 28 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 29 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 30 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 31 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 32 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 33 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 34 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 37 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 38 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 39 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 40 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 41 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 42 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 43 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10716877 | 3300010049 | Bacteria | 1170 |
| 2 | Ga0123356_11563382 | 3300010049 | Bacteria | 815 |
| 3 | Ga0123353_10686187 | 3300010167 | Unclassified | 1441 |
| 4 | Ga0123353_10783357 | 3300010167 | Bacteria | 1320 |
| 5 | Ga0466657_217663 | 3300042582 | Bacteria | 1079 |
| 6 | Ga0466694_235537 | 3300042594 | Archaea | 1256 |
| 7 | Ga0466722_150886 | 3300042609 | Bacteria | 3280 |
| 8 | JGI24705J35276_11838292 | 3300002504 | Bacteria | 707 |
| 9 | Ga0072940_1113562 | 3300005200 | Archaea | 763 |
| 10 | Ga0466731_035468 | 3300042622 | Unclassified | 1937 |
| 11 | Ga0466734_162335 | 3300042623 | Unclassified | 1026 |
| 12 | Ga0466718_011460 | 3300042617 | Bacteria | 2087 |
| 13 | Ga0123353_10436556 | 3300010167 | Bacteria | 1933 |
| 14 | Ga0415639_157231 | 3300038395 | Bacteria | 1220 |
| 15 | Ga0466693_268105 | 3300042592 | Bacteria | 1733 |
| 16 | Ga0466693_349608 | 3300042592 | Bacteria | 2019 |
| 17 | Ga0466691_025627 | 3300042593 | Unclassified | 2001 |
| 18 | Ga0466691_219786 | 3300042593 | Unclassified | 2659 |
| 19 | Ga0466694_188519 | 3300042594 | Archaea | 1076 |
| 20 | Ga0466694_275081 | 3300042594 | Bacteria | 1524 |
| 21 | Ga0466696_142536 | 3300042596 | Bacteria | 1658 |
| 22 | Ga0466696_192573 | 3300042596 | Bacteria | 5743 |
| 23 | Ga0466700_349245 | 3300042600 | Unclassified | 1855 |
| 24 | Ga0466700_392844 | 3300042600 | Bacteria | 1290 |
| 25 | Ga0466700_443517 | 3300042600 | Bacteria | 1203 |
| 26 | JGI24702J35022_10218173 | 3300002462 | Bacteria | 1098 |
| 27 | Ga0072941_1262486 | 3300005201 | Bacteria | 732 |
| 28 | Ga0466705_383749 | 3300042612 | Bacteria | 32511 |
| 29 | Ga0466733_101890 | 3300042659 | Bacteria | 2564 |
| 30 | Ga0466715_162482 | 3300042616 | Bacteria | 2706 |
| 31 | Ga0466718_074936 | 3300042617 | Bacteria | 1640 |
| 32 | Ga0123356_10386128 | 3300010049 | Bacteria | 1534 |
| 33 | Ga0123353_10657762 | 3300010167 | Bacteria | 1482 |
| 34 | Ga0123353_11418245 | 3300010167 | Archaea | 891 |
| 35 | Ga0466693_029052 | 3300042592 | Unclassified | 1027 |
| 36 | Ga0466701_029062 | 3300042598 | Bacteria | 3542 |
| 37 | Ga0466700_373865 | 3300042600 | Bacteria | 1252 |
| 38 | JGI24695J34938_10049043 | 3300002450 | Bacteria | 1857 |
| 39 | JGI24695J34938_10073326 | 3300002450 | Unclassified | 1426 |
| 40 | JGI24702J35022_10355360 | 3300002462 | Bacteria | 877 |
| 41 | Ga0074263_100622 | 3300005485 | Unclassified | 2188 |
| 42 | Ga0466731_386701 | 3300042622 | Unclassified | 1458 |
| 43 | Ga0466697_230419 | 3300042611 | Bacteria | 1140 |
| 44 | Ga0466733_022806 | 3300042659 | Bacteria | 1814 |
| 45 | Ga0466710_044592 | 3300042613 | Bacteria | 1968 |
| 46 | Ga0466723_079592 | 3300042618 | Bacteria | 3477 |
| 47 | Ga0123356_10168418 | 3300010049 | Bacteria | 2198 |
| 48 | Ga0123356_10767043 | 3300010049 | Unclassified | 1135 |
| 49 | Ga0123353_10689245 | 3300010167 | Bacteria | 1437 |
| 50 | Ga0123354_10191214 | 3300010882 | Archaea | 2291 |
| 51 | Ga0466656_072970 | 3300042550 | Unclassified | 1474 |
| 52 | Ga0466691_060037 | 3300042593 | Bacteria | 10452 |
| 53 | Ga0466694_146673 | 3300042594 | Bacteria | 2179 |
| 54 | Ga0466701_083131 | 3300042598 | Bacteria | 1417 |
| 55 | Ga0466717_284382 | 3300042604 | Unclassified | 1480 |
| 56 | JGI24702J35022_10483535 | 3300002462 | Bacteria | 757 |
| 57 | Ga0466704_170250 | 3300042643 | Bacteria | 9534 |
| 58 | Ga0466704_252832 | 3300042643 | Bacteria | 2148 |
| 59 | Ga0466718_161653 | 3300042617 | Archaea | 1460 |
| 60 | Ga0123356_10898356 | 3300010049 | Bacteria | 1057 |
| 61 | Ga0123353_10365671 | 3300010167 | Bacteria | 2165 |
| 62 | Ga0123353_11901181 | 3300010167 | Archaea | 734 |
| 63 | Ga0123353_12143832 | 3300010167 | Archaea | 678 |
| 64 | Ga0415639_117916 | 3300038395 | Bacteria | 1256 |
| 65 | Ga0466695_119537 | 3300042595 | Unclassified | 1848 |
| 66 | Ga0466696_073530 | 3300042596 | Bacteria | 1894 |
| 67 | Ga0466696_094981 | 3300042596 | Bacteria | 4347 |
| 68 | Ga0466696_107964 | 3300042596 | Bacteria | 1538 |
| 69 | Ga0466696_214146 | 3300042596 | Unclassified | 1577 |
| 70 | Ga0466701_047426 | 3300042598 | Bacteria | 3795 |
| 71 | Ga0466717_022823 | 3300042604 | Bacteria | 1150 |
| 72 | Ga0466731_223003 | 3300042622 | Unclassified | 1999 |
| 73 | Ga0466734_093883 | 3300042623 | Bacteria | 1213 |
| 74 | Ga0466702_003716 | 3300042635 | Bacteria | 1142 |
| 75 | Ga0466725_061175 | 3300042654 | Bacteria | 1573 |
| 76 | Ga0466733_206077 | 3300042659 | Bacteria | 1348 |
| 77 | Ga0466723_009217 | 3300042618 | Bacteria | 1743 |
| 78 | Ga0466728_212165 | 3300042620 | Bacteria | 3853 |
| 79 | Ga0123356_10431039 | 3300010049 | Bacteria | 1463 |
| 80 | Ga0123356_12542796 | 3300010049 | Bacteria | 641 |
| 81 | Ga0123353_11451054 | 3300010167 | Bacteria | 878 |
| 82 | Ga0466693_309653 | 3300042592 | Bacteria | 1411 |
| 83 | Ga0466693_389680 | 3300042592 | Unclassified | 1051 |
| 84 | Ga0466701_072830 | 3300042598 | Bacteria | 1602 |
| 85 | Ga0466721_329163 | 3300042608 | Bacteria | 1319 |
| 86 | Ga0466722_126375 | 3300042609 | Archaea | 1965 |
| 87 | JGI24702J35022_10192349 | 3300002462 | Bacteria | 1164 |
| 88 | JGI24702J35022_10425814 | 3300002462 | Bacteria | 805 |
| 89 | JGI24705J35276_12048714 | 3300002504 | Unclassified | 915 |
| 90 | Ga0466702_096884 | 3300042635 | Bacteria | 1568 |
| 91 | Ga0466725_325473 | 3300042654 | Bacteria | 2725 |
| 92 | Ga0466697_142000 | 3300042611 | Bacteria | 1685 |
| 93 | Ga0466723_096893 | 3300042618 | Bacteria | 2350 |
| 94 | Ga0123355_10003847 | 3300009826 | Bacteria | 21716 |
| 95 | Ga0123355_10549300 | 3300009826 | Bacteria | 1398 |
| 96 | Ga0123356_10534086 | 3300010049 | Bacteria | 1332 |
| 97 | Ga0466694_133138 | 3300042594 | Bacteria | 9904 |
| 98 | Ga0466701_064861 | 3300042598 | Bacteria | 1654 |
| 99 | Ga0466701_097728 | 3300042598 | Bacteria | 1092 |
| 100 | Ga0466717_276440 | 3300042604 | Archaea | 1455 |
| 101 | Ga0466698_336173 | 3300042610 | Bacteria | 1636 |
| 102 | JGI24695J34938_10013286 | 3300002450 | Bacteria | 4331 |
| 103 | JGI24700J35501_10355497 | 3300002508 | Bacteria | 649 |
| 104 | Ga0072941_1134534 | 3300005201 | Bacteria | 759 |
| 105 | Ga0466724_33287 | 3300042649 | Bacteria | 1376 |
| 106 | Ga0466718_075314 | 3300042617 | Bacteria | 1093 |
| 107 | Ga0123356_10376939 | 3300010049 | Bacteria | 1550 |
| 108 | Ga0123353_10772305 | 3300010167 | Unclassified | 1333 |
| 109 | Ga0123354_10269678 | 3300010882 | Bacteria | 1678 |
| 110 | Ga0123354_10349376 | 3300010882 | Bacteria | 1321 |
| 111 | Ga0466694_130300 | 3300042594 | Bacteria | 1541 |
| 112 | Ga0466696_190597 | 3300042596 | Bacteria | 1362 |
| 113 | Ga0466701_015202 | 3300042598 | Bacteria | 1627 |
| 114 | Ga0466698_052220 | 3300042610 | Bacteria | 2325 |
| 115 | JGI24696J40584_12911302 | 3300002834 | Bacteria | 1258 |
| 116 | Ga0466734_096095 | 3300042623 | Bacteria | 1360 |
| 117 | Ga0466709_399299 | 3300042648 | Bacteria | 1399 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.