Protein Family IF05128
Metagenome
Isolate
204
Members
57
Samples
194
Scaffolds
223.91
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_082907|Ga0466696_082907_3457_4227
- Length
- 256 aa
- Sequence
- MPAEEYSVDSNKRRSGQDKQDQTQNNLLKSSDMKFTKIQVLTAMQQTGLVPVYYNSDTATAKNVLKACYNGGIRAFEFTNRGDFAHEVFGELVKFAAKECPEMILGIGSIVESGSASLYIQLGANFVVGPSFNPDVAKICNRRLVPYTPGCGSVSEVGAAQEVGCDLCKVFPGDVLGPHFVKGLRAPMPWSMLMVTGGVKPEESNLKSWFDAGVTCVGMGSNLFPSDLVNAKNWDGITRLCSDTLAIIKKTRTSGQ
Sample Types
Isolate
4.9%
Metagenome
95.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.1%
Kalotermitidae
25.0%
Blattidae
12.5%
Unclassified
8.9%
Termopsidae
7.1%
Rhinotermitidae
7.1%
Passalidae
5.4%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
193
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 2 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 3 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 4 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 13 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 14 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 15 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 16 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 17 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 18 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 19 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 20 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 25 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 26 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 27 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 28 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 31 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 32 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 33 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 34 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 37 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 38 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 42 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 43 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 44 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 45 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 46 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 47 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 48 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 49 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 50 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 51 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 52 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 55 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 56 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 57 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466735_147561 | 3300042624 | Bacteria | 1100 |
| 2 | Ga0466704_084077 | 3300042643 | Bacteria | 17157 |
| 3 | Ga0466704_421307 | 3300042643 | Bacteria | 4486 |
| 4 | Ga0466727_053371 | 3300042655 | Bacteria | 10852 |
| 5 | Ga0466727_145522 | 3300042655 | Bacteria | 16431 |
| 6 | Ga0466707_259090 | 3300042601 | Bacteria | 2451 |
| 7 | Ga0466713_116299 | 3300042602 | Bacteria | 1842 |
| 8 | Ga0466716_199903 | 3300042605 | Bacteria | 5808 |
| 9 | Ga0466716_544085 | 3300042605 | Bacteria | 17149 |
| 10 | Ga0466690_126533 | 3300042590 | Bacteria | 1201 |
| 11 | Ga0466691_006306 | 3300042593 | Bacteria | 3827 |
| 12 | Ga0466696_082907 | 3300042596 | Bacteria | 4944 |
| 13 | Ga0123356_10135251 | 3300010049 | Bacteria | 2422 |
| 14 | Ga0123356_11203288 | 3300010049 | Bacteria | 924 |
| 15 | IMNBL1DRAFT_c0013990 | 3300000062 | Bacteria | 3567 |
| 16 | IMNBL1DRAFT_c0042269 | 3300000062 | Bacteria | 1521 |
| 17 | Ga0068305_10007041 | 3300005083 | Bacteria | 12442 |
| 18 | Ga0466711_308404 | 3300042615 | Bacteria | 17331 |
| 19 | Ga0466711_392680 | 3300042615 | Bacteria | 13459 |
| 20 | Ga0466715_407960 | 3300042616 | Bacteria | 6940 |
| 21 | Ga0466726_415753 | 3300042619 | Bacteria | 3581 |
| 22 | Ga0466728_362487 | 3300042620 | Bacteria | 4663 |
| 23 | Ga0466703_315169 | 3300042636 | Bacteria | 3885 |
| 24 | Ga0466704_215711 | 3300042643 | Bacteria | 2093 |
| 25 | Ga0466706_055883 | 3300042599 | Bacteria | 5103 |
| 26 | Ga0466713_029016 | 3300042602 | Bacteria | 1959 |
| 27 | Ga0466713_121905 | 3300042602 | Bacteria | 15307 |
| 28 | Ga0466714_148962 | 3300042603 | Unclassified | 1245 |
| 29 | Ga0466714_157561 | 3300042603 | Bacteria | 10125 |
| 30 | Ga0466719_131565 | 3300042606 | Bacteria | 6872 |
| 31 | Ga0466722_139145 | 3300042609 | Bacteria | 3688 |
| 32 | Ga0466690_291376 | 3300042590 | Bacteria | 7530 |
| 33 | Ga0123356_10243329 | 3300010049 | Bacteria | 1871 |
| 34 | Ga0123353_10369808 | 3300010167 | Bacteria | 2150 |
| 35 | 2227069685 | 2225789003 | Bacteria | 13369 |
| 36 | JGI24702J35022_10000876 | 3300002462 | Bacteria | 18643 |
| 37 | JGI24702J35022_10006255 | 3300002462 | Bacteria | 6889 |
| 38 | JGI24702J35022_10016621 | 3300002462 | Bacteria | 4031 |
| 39 | Ga0068305_10038085 | 3300005083 | Bacteria | 18850 |
| 40 | Ga0466711_027826 | 3300042615 | Bacteria | 7078 |
| 41 | Ga0466715_040739 | 3300042616 | Bacteria | 29108 |
| 42 | Ga0466723_168825 | 3300042618 | Bacteria | 24885 |
| 43 | Ga0466723_183847 | 3300042618 | Bacteria | 12292 |
| 44 | Ga0466723_221683 | 3300042618 | Bacteria | 3344 |
| 45 | Ga0466728_119729 | 3300042620 | Bacteria | 13479 |
| 46 | Ga0466705_019478 | 3300042612 | Bacteria | 1038 |
| 47 | Ga0466733_004056 | 3300042659 | Bacteria | 4976 |
| 48 | Ga0466735_004567 | 3300042624 | Bacteria | 1638 |
| 49 | Ga0466735_031903 | 3300042624 | Bacteria | 1762 |
| 50 | Ga0466735_040128 | 3300042624 | Bacteria | 1182 |
| 51 | Ga0466735_144367 | 3300042624 | Bacteria | 2166 |
| 52 | Ga0466727_294554 | 3300042655 | Bacteria | 5026 |
| 53 | Ga0466706_017038 | 3300042599 | Bacteria | 50770 |
| 54 | Ga0466706_036009 | 3300042599 | Bacteria | 4788 |
| 55 | Ga0466713_028347 | 3300042602 | Bacteria | 9092 |
| 56 | Ga0466713_038658 | 3300042602 | Bacteria | 11743 |
| 57 | Ga0466713_063807 | 3300042602 | Bacteria | 6440 |
| 58 | Ga0466713_091524 | 3300042602 | Bacteria | 31228 |
| 59 | Ga0466714_020636 | 3300042603 | Bacteria | 1874 |
| 60 | Ga0466716_139527 | 3300042605 | Bacteria | 30382 |
| 61 | Ga0466719_235063 | 3300042606 | Bacteria | 1551 |
| 62 | Ga0466698_140456 | 3300042610 | Bacteria | 4387 |
| 63 | Ga0466690_041120 | 3300042590 | Bacteria | 21497 |
| 64 | Ga0466690_241549 | 3300042590 | Bacteria | 6321 |
| 65 | Ga0466692_023160 | 3300042591 | Bacteria | 9066 |
| 66 | Ga0466696_165047 | 3300042596 | Bacteria | 4624 |
| 67 | Ga0123357_10286656 | 3300009784 | Bacteria | 1690 |
| 68 | Ga0123356_10403646 | 3300010049 | Bacteria | 1505 |
| 69 | 2227530172 | 2225789004 | Bacteria | 16460 |
| 70 | IMNBL1DRAFT_c0002572 | 3300000062 | Bacteria | 12503 |
| 71 | JGI24695J34938_10089272 | 3300002450 | Bacteria | 1266 |
| 72 | Ga0068302_10014307 | 3300005071 | Bacteria | 12890 |
| 73 | Ga0466705_520303 | 3300042612 | Bacteria | 1032 |
| 74 | Ga0466715_232351 | 3300042616 | Bacteria | 13419 |
| 75 | Ga0466718_145752 | 3300042617 | Bacteria | 1125 |
| 76 | Ga0466723_088540 | 3300042618 | Bacteria | 24372 |
| 77 | Ga0466705_140360 | 3300042612 | Bacteria | 13000 |
| 78 | Ga0466733_117251 | 3300042659 | Bacteria | 91507 |
| 79 | Ga0466733_131889 | 3300042659 | Bacteria | 9326 |
| 80 | Ga0466733_215504 | 3300042659 | Bacteria | 1940 |
| 81 | Ga0466729_275873 | 3300042621 | Bacteria | 4294 |
| 82 | Ga0466703_070152 | 3300042636 | Bacteria | 6480 |
| 83 | Ga0466708_246063 | 3300042652 | Bacteria | 25365 |
| 84 | Ga0466727_083717 | 3300042655 | Bacteria | 8189 |
| 85 | Ga0466706_236412 | 3300042599 | Bacteria | 28792 |
| 86 | Ga0466713_025355 | 3300042602 | Bacteria | 7532 |
| 87 | Ga0466657_178383 | 3300042582 | Unclassified | 5730 |
| 88 | Ga0466690_018339 | 3300042590 | Bacteria | 7473 |
| 89 | Ga0466690_090392 | 3300042590 | Bacteria | 1266 |
| 90 | Ga0466693_050116 | 3300042592 | Bacteria | 1810 |
| 91 | Ga0466691_039676 | 3300042593 | Unclassified | 12508 |
| 92 | Ga0466691_223859 | 3300042593 | Bacteria | 26799 |
| 93 | Ga0466696_124994 | 3300042596 | Bacteria | 7307 |
| 94 | Ga0123353_10159842 | 3300010167 | Bacteria | 3588 |
| 95 | Ga0123353_10777544 | 3300010167 | Bacteria | 1327 |
| 96 | Ga0123354_10180102 | 3300010882 | Bacteria | 2417 |
| 97 | Ga0068302_10216216 | 3300005071 | Unclassified | 4484 |
| 98 | Ga0466705_476341 | 3300042612 | Bacteria | 12361 |
| 99 | Ga0466715_049724 | 3300042616 | Bacteria | 14178 |
| 100 | Ga0466726_410350 | 3300042619 | Bacteria | 6589 |
| 101 | Ga0466733_218157 | 3300042659 | Bacteria | 2712 |
| 102 | Ga0466704_054440 | 3300042643 | Bacteria | 16809 |
| 103 | Ga0466709_336303 | 3300042648 | Bacteria | 2365 |
| 104 | Ga0466708_231449 | 3300042652 | Bacteria | 7016 |
| 105 | Ga0466708_293118 | 3300042652 | Bacteria | 9389 |
| 106 | Ga0466701_059539 | 3300042598 | Bacteria | 71898 |
| 107 | Ga0466706_025114 | 3300042599 | Bacteria | 2064 |
| 108 | Ga0466706_211737 | 3300042599 | Bacteria | 1682 |
| 109 | Ga0466706_250156 | 3300042599 | Bacteria | 11504 |
| 110 | Ga0466714_006756 | 3300042603 | Bacteria | 211810 |
| 111 | Ga0466722_042520 | 3300042609 | Bacteria | 9397 |
| 112 | Ga0466696_181868 | 3300042596 | Bacteria | 6179 |
| 113 | Ga0466696_230688 | 3300042596 | Bacteria | 36968 |
| 114 | Ga0123353_10108930 | 3300010167 | Bacteria | 4463 |
| 115 | Ga0123354_10173318 | 3300010882 | Bacteria | 2499 |
| 116 | Ga0466710_020446 | 3300042613 | Bacteria | 1230 |
| 117 | Ga0466711_405589 | 3300042615 | Bacteria | 4266 |
| 118 | Ga0466715_242562 | 3300042616 | Bacteria | 39443 |
| 119 | Ga0466726_155838 | 3300042619 | Bacteria | 18951 |
| 120 | Ga0466728_087702 | 3300042620 | Bacteria | 35663 |
| 121 | Ga0466697_133856 | 3300042611 | Bacteria | 1899 |
| 122 | Ga0466697_179409 | 3300042611 | Bacteria | 152612 |
| 123 | Ga0466703_304167 | 3300042636 | Bacteria | 2991 |
| 124 | Ga0466708_141991 | 3300042652 | Bacteria | 46886 |
| 125 | Ga0466725_209256 | 3300042654 | Bacteria | 1161 |
| 126 | Ga0466725_211683 | 3300042654 | Bacteria | 11769 |
| 127 | Ga0466706_085050 | 3300042599 | Bacteria | 34505 |
| 128 | Ga0466707_065891 | 3300042601 | Bacteria | 6593 |
| 129 | Ga0466713_073291 | 3300042602 | Bacteria | 42324 |
| 130 | Ga0466713_077572 | 3300042602 | Bacteria | 13878 |
| 131 | Ga0466714_006646 | 3300042603 | Bacteria | 2665 |
| 132 | Ga0466716_210934 | 3300042605 | Bacteria | 22432 |
| 133 | Ga0466719_069723 | 3300042606 | Bacteria | 1569 |
| 134 | Ga0265387_1000217 | 3300024582 | Bacteria | 10028 |
| 135 | Ga0415639_004716 | 3300038395 | Unclassified | 2199 |
| 136 | Ga0466690_087584 | 3300042590 | Bacteria | 2236 |
| 137 | Ga0466691_203953 | 3300042593 | Bacteria | 6505 |
| 138 | Ga0466696_035748 | 3300042596 | Bacteria | 10479 |
| 139 | Ga0466696_167826 | 3300042596 | Bacteria | 25872 |
| 140 | Ga0466696_230918 | 3300042596 | Bacteria | 7431 |
| 141 | Ga0123356_11183700 | 3300010049 | Bacteria | 931 |
| 142 | Ga0123353_10051919 | 3300010167 | Bacteria | 6545 |
| 143 | Ga0123353_10194288 | 3300010167 | Bacteria | 3200 |
| 144 | IMNBL1DRAFT_c0025120 | 3300000062 | Unclassified | 2291 |
| 145 | Ga0068302_10158787 | 3300005071 | Unclassified | 2186 |
| 146 | Ga0466712_268526 | 3300042614 | Bacteria | 2363 |
| 147 | Ga0466723_023862 | 3300042618 | Bacteria | 63714 |
| 148 | Ga0466723_030624 | 3300042618 | Bacteria | 7963 |
| 149 | Ga0466726_117919 | 3300042619 | Bacteria | 12892 |
| 150 | Ga0466735_001680 | 3300042624 | Bacteria | 2727 |
| 151 | Ga0466735_061328 | 3300042624 | Unclassified | 1431 |
| 152 | Ga0466735_128324 | 3300042624 | Unclassified | 1555 |
| 153 | Ga0466735_223431 | 3300042624 | Bacteria | 1530 |
| 154 | Ga0466703_122833 | 3300042636 | Bacteria | 5687 |
| 155 | Ga0466708_170694 | 3300042652 | Bacteria | 1066 |
| 156 | Ga0466719_021140 | 3300042606 | Bacteria | 5135 |
| 157 | Ga0466690_035455 | 3300042590 | Bacteria | 5420 |
| 158 | Ga0466690_066024 | 3300042590 | Bacteria | 3029 |
| 159 | Ga0466692_100658 | 3300042591 | Bacteria | 10980 |
| 160 | Ga0466696_043029 | 3300042596 | Bacteria | 6070 |
| 161 | Ga0123356_10040032 | 3300010049 | Bacteria | 4367 |
| 162 | Ga0123354_10092569 | 3300010882 | Bacteria | 4163 |
| 163 | 2227273572 | 2225789004 | Unclassified | 1273 |
| 164 | 2227519087 | 2225789004 | Bacteria | 17332 |
| 165 | 2227530164 | 2225789004 | Bacteria | 16506 |
| 166 | JGI24702J35022_10128828 | 3300002462 | Bacteria | 1403 |
| 167 | Ga0068302_10446336 | 3300005071 | Bacteria | 1387 |
| 168 | Ga0068305_10106944 | 3300005083 | Bacteria | 5176 |
| 169 | Ga0466710_146784 | 3300042613 | Bacteria | 1717 |
| 170 | Ga0466711_468146 | 3300042615 | Bacteria | 29475 |
| 171 | Ga0466726_458032 | 3300042619 | Bacteria | 1853 |
| 172 | Ga0466729_019787 | 3300042621 | Bacteria | 1627 |
| 173 | Ga0466705_260081 | 3300042612 | Bacteria | 7919 |
| 174 | Ga0466705_326516 | 3300042612 | Bacteria | 6288 |
| 175 | Ga0466733_199272 | 3300042659 | Bacteria | 7313 |
| 176 | Ga0466703_116500 | 3300042636 | Bacteria | 4619 |
| 177 | Ga0466704_376819 | 3300042643 | Bacteria | 49548 |
| 178 | Ga0466709_055818 | 3300042648 | Bacteria | 52555 |
| 179 | Ga0466709_226061 | 3300042648 | Bacteria | 3918 |
| 180 | Ga0466708_208353 | 3300042652 | Bacteria | 3073 |
| 181 | Ga0466707_002063 | 3300042601 | Bacteria | 2797 |
| 182 | Ga0466713_042598 | 3300042602 | Bacteria | 13134 |
| 183 | Ga0466716_486782 | 3300042605 | Bacteria | 3093 |
| 184 | Ga0466719_079794 | 3300042606 | Bacteria | 11280 |
| 185 | Ga0466722_178165 | 3300042609 | Bacteria | 29947 |
| 186 | Ga0466690_186184 | 3300042590 | Bacteria | 2122 |
| 187 | Ga0123353_10091418 | 3300010167 | Bacteria | 4902 |
| 188 | 2227485471 | 2225789004 | Bacteria | 4268 |
| 189 | IMNBL1DRAFT_c0001348 | 3300000062 | Bacteria | 18506 |
| 190 | IMNBL1DRAFT_c0002077 | 3300000062 | Unclassified | 14281 |
| 191 | IMNBL1DRAFT_c0088258 | 3300000062 | Bacteria | 855 |
| 192 | JGI24702J35022_10369989 | 3300002462 | Bacteria | 860 |
| 193 | Ga0466711_517412 | 3300042615 | Bacteria | 12377 |
| 194 | Ga0466715_220301 | 3300042616 | Bacteria | 20393 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01081 | Aldolase | KDPG and KHG aldolase | 43 | 240 | 0.94 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01081 | GO:0016829 | lyase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.