Protein Family IF05112
Metagenome
Isolate
249
Members
75
Samples
223
Scaffolds
289.83
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_059095|Ga0466696_059095_28002_28976
- Length
- 324 aa
- Sequence
- MRFTQTHKESLTADGLFASFRKEIIGLQSETPLHFMKHIAASELIINEDGSVFHLHIKPEHLADRIILCGDPARVSLIAGYFDTKECDISNREFYTITGTYEGKRISVVSHGIGCDNIDIVINELDALANIDFATRTVRPVFRQLTLVRIGTSGGLQPYTPVGSYVAAEKSIGFDGVIYFYKDHEKVRDIRMEDELIRQLDWDITGIRPYVVSADTSLIEQITKDDIIRGMTIAANGFYGPQGRELRLPLNDPELNRKIEAFHFEDRHITNFEMESSALAGLATLMGHRAMTVCCIIAGRVDKTMNTDYKNSLPILIKKVLNRI
Sample Types
Isolate
10.4%
Metagenome
89.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
32.0%
Termitidae
24.0%
Kalotermitidae
18.7%
Termopsidae
5.3%
Rhinotermitidae
5.3%
Unclassified
5.3%
Passalidae
4.0%
Drosophilidae
1.3%
Culicidae
1.3%
Hodotermitidae
1.3%
Armadillidiidae
1.3%
Taxonomy
Archaea
1
Bacteria
244
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 2 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 3 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 4 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 14 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 21 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 22 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 23 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 24 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 31 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 32 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 33 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 38 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 39 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 40 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 41 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 42 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 43 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 44 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 45 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 46 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 47 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 48 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 49 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 50 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 51 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 52 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 53 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 54 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 55 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 56 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 57 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 58 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 59 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 60 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 61 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 62 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 63 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 64 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 65 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 66 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 67 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 68 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 69 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 70 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 71 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 72 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 73 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 74 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 75 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_156258 | 3300042659 | Bacteria | 22768 |
| 2 | Ga0466711_142014 | 3300042615 | Bacteria | 2934 |
| 3 | Ga0466715_265889 | 3300042616 | Bacteria | 8572 |
| 4 | Ga0466715_277624 | 3300042616 | Bacteria | 6956 |
| 5 | Ga0466715_333374 | 3300042616 | Bacteria | 37993 |
| 6 | Ga0466718_043337 | 3300042617 | Bacteria | 2059 |
| 7 | Ga0466723_222585 | 3300042618 | Bacteria | 10799 |
| 8 | Ga0466728_468624 | 3300042620 | Bacteria | 1963 |
| 9 | Ga0466706_002888 | 3300042599 | Bacteria | 1296 |
| 10 | Ga0466706_049855 | 3300042599 | Bacteria | 1975 |
| 11 | Ga0466706_099249 | 3300042599 | Bacteria | 2406 |
| 12 | Ga0466713_016441 | 3300042602 | Bacteria | 3690 |
| 13 | Ga0466714_048416 | 3300042603 | Bacteria | 2143 |
| 14 | Ga0466716_412583 | 3300042605 | Bacteria | 5523 |
| 15 | Ga0466719_239728 | 3300042606 | Bacteria | 6354 |
| 16 | 2227469916 | 2225789004 | Bacteria | 4945 |
| 17 | Ga0466703_122336 | 3300042636 | Bacteria | 17647 |
| 18 | Ga0466704_077949 | 3300042643 | Bacteria | 2799 |
| 19 | Ga0466704_274178 | 3300042643 | Bacteria | 1592 |
| 20 | Ga0466709_377052 | 3300042648 | Bacteria | 4712 |
| 21 | Ga0466708_070160 | 3300042652 | Bacteria | 39155 |
| 22 | Ga0466725_056801 | 3300042654 | Bacteria | 12353 |
| 23 | Ga0160445_116515 | 3300012847 | Bacteria | 1012 |
| 24 | Ga0466690_314683 | 3300042590 | Bacteria | 8921 |
| 25 | Ga0466692_005723 | 3300042591 | Bacteria | 1589 |
| 26 | Ga0466691_038509 | 3300042593 | Bacteria | 14731 |
| 27 | Ga0123353_10250862 | 3300010167 | Bacteria | 2741 |
| 28 | Ga0466705_046808 | 3300042612 | Bacteria | 25523 |
| 29 | Ga0466705_236020 | 3300042612 | Bacteria | 47478 |
| 30 | Ga0466711_205937 | 3300042615 | Bacteria | 1234 |
| 31 | Ga0466715_312116 | 3300042616 | Bacteria | 38473 |
| 32 | Ga0466715_417283 | 3300042616 | Bacteria | 3682 |
| 33 | Ga0466723_039609 | 3300042618 | Bacteria | 24007 |
| 34 | Ga0466728_168026 | 3300042620 | Bacteria | 2809 |
| 35 | Ga0466729_062806 | 3300042621 | Bacteria | 7472 |
| 36 | Ga0466706_163858 | 3300042599 | Bacteria | 1893 |
| 37 | Ga0466706_189473 | 3300042599 | Bacteria | 52664 |
| 38 | Ga0466713_089478 | 3300042602 | Bacteria | 2997 |
| 39 | Ga0466719_175000 | 3300042606 | Bacteria | 6310 |
| 40 | 2227469070 | 2225789004 | Bacteria | 24162 |
| 41 | IMNBL1DRAFT_c0061005 | 3300000062 | Bacteria | 1134 |
| 42 | JGI24696J40584_12953894 | 3300002834 | Bacteria | 2552 |
| 43 | Ga0068305_10000404 | 3300005083 | Bacteria | 146706 |
| 44 | Ga0466735_232423 | 3300042624 | Bacteria | 1846 |
| 45 | Ga0466704_062294 | 3300042643 | Bacteria | 12956 |
| 46 | Ga0466704_565577 | 3300042643 | Bacteria | 39753 |
| 47 | Ga0466709_105464 | 3300042648 | Bacteria | 22179 |
| 48 | Ga0466656_117438 | 3300042550 | Bacteria | 20246 |
| 49 | Ga0466690_020123 | 3300042590 | Bacteria | 29483 |
| 50 | Ga0466696_036064 | 3300042596 | Bacteria | 108856 |
| 51 | Ga0466696_059095 | 3300042596 | Bacteria | 32844 |
| 52 | Ga0466696_091885 | 3300042596 | Bacteria | 2030 |
| 53 | Ga0466696_115243 | 3300042596 | Bacteria | 2935 |
| 54 | Ga0466696_211084 | 3300042596 | Bacteria | 5911 |
| 55 | Ga0466723_026925 | 3300042618 | Bacteria | 6238 |
| 56 | Ga0466706_068424 | 3300042599 | Bacteria | 45002 |
| 57 | Ga0466706_227704 | 3300042599 | Bacteria | 3403 |
| 58 | Ga0466707_403420 | 3300042601 | Bacteria | 1626 |
| 59 | Ga0466716_534786 | 3300042605 | Bacteria | 11566 |
| 60 | 2227482988 | 2225789004 | Bacteria | 21506 |
| 61 | IMNBL1DRAFT_c0000452 | 3300000062 | Bacteria | 34320 |
| 62 | IMNBL1DRAFT_c0000475 | 3300000062 | Bacteria | 33592 |
| 63 | JGI24702J35022_10001686 | 3300002462 | Bacteria | 13705 |
| 64 | Ga0104045_1074563 | 3300007085 | Bacteria | 2808 |
| 65 | Ga0466709_325455 | 3300042648 | Bacteria | 4746 |
| 66 | Ga0466727_060642 | 3300042655 | Bacteria | 26590 |
| 67 | Ga0466727_125678 | 3300042655 | Bacteria | 15651 |
| 68 | Ga0466727_152141 | 3300042655 | Bacteria | 14409 |
| 69 | Ga0466727_247582 | 3300042655 | Bacteria | 15154 |
| 70 | Ga0466691_034333 | 3300042593 | Bacteria | 17570 |
| 71 | Ga0123353_10225222 | 3300010167 | Bacteria | 2928 |
| 72 | Ga0123354_10273489 | 3300010882 | Bacteria | 1657 |
| 73 | Ga0466732_036177 | 3300042656 | Unclassified | 3388 |
| 74 | Ga0466733_022782 | 3300042659 | Bacteria | 2326 |
| 75 | Ga0466711_237432 | 3300042615 | Bacteria | 2339 |
| 76 | Ga0466715_178688 | 3300042616 | Bacteria | 9520 |
| 77 | Ga0466715_240953 | 3300042616 | Bacteria | 36603 |
| 78 | Ga0466706_193728 | 3300042599 | Bacteria | 7854 |
| 79 | Ga0466713_008308 | 3300042602 | Bacteria | 16061 |
| 80 | Ga0466719_161944 | 3300042606 | Bacteria | 4619 |
| 81 | Ga0466719_563086 | 3300042606 | Bacteria | 6655 |
| 82 | Ga0466722_044823 | 3300042609 | Bacteria | 5022 |
| 83 | Ga0466722_153778 | 3300042609 | Bacteria | 4497 |
| 84 | Ga0466722_208741 | 3300042609 | Bacteria | 1082 |
| 85 | Ga0068305_10025862 | 3300005083 | Bacteria | 7195 |
| 86 | Ga0068305_10357034 | 3300005083 | Bacteria | 3472 |
| 87 | Ga0068305_10600774 | 3300005083 | Bacteria | 2565 |
| 88 | Ga0466703_056502 | 3300042636 | Bacteria | 16463 |
| 89 | Ga0466703_100935 | 3300042636 | Bacteria | 13355 |
| 90 | Ga0466704_019352 | 3300042643 | Bacteria | 25390 |
| 91 | Ga0466704_202585 | 3300042643 | Bacteria | 23604 |
| 92 | Ga0466704_448258 | 3300042643 | Unclassified | 14110 |
| 93 | Ga0466708_035884 | 3300042652 | Bacteria | 37329 |
| 94 | Ga0466708_180067 | 3300042652 | Bacteria | 29640 |
| 95 | Ga0466727_092283 | 3300042655 | Bacteria | 12106 |
| 96 | Ga0466690_157155 | 3300042590 | Bacteria | 1333 |
| 97 | Ga0466690_279060 | 3300042590 | Bacteria | 7495 |
| 98 | Ga0466690_360277 | 3300042590 | Bacteria | 13929 |
| 99 | Ga0466690_394866 | 3300042590 | Bacteria | 116329 |
| 100 | Ga0466691_062187 | 3300042593 | Bacteria | 10482 |
| 101 | Ga0466696_014006 | 3300042596 | Bacteria | 15558 |
| 102 | Ga0123353_10010584 | 3300010167 | Bacteria | 12874 |
| 103 | Ga0466705_160132 | 3300042612 | Bacteria | 1305 |
| 104 | Ga0466705_372583 | 3300042612 | Bacteria | 1695 |
| 105 | Ga0466711_012851 | 3300042615 | Bacteria | 13772 |
| 106 | Ga0466711_380006 | 3300042615 | Archaea | 2587 |
| 107 | Ga0466715_068659 | 3300042616 | Bacteria | 10068 |
| 108 | Ga0466715_431128 | 3300042616 | Bacteria | 8361 |
| 109 | Ga0466715_510272 | 3300042616 | Bacteria | 32257 |
| 110 | Ga0466726_054626 | 3300042619 | Bacteria | 5767 |
| 111 | Ga0466706_157421 | 3300042599 | Bacteria | 9861 |
| 112 | Ga0466706_282240 | 3300042599 | Bacteria | 9624 |
| 113 | Ga0466700_317907 | 3300042600 | Bacteria | 5722 |
| 114 | Ga0466700_354725 | 3300042600 | Bacteria | 2472 |
| 115 | Ga0466713_092082 | 3300042602 | Bacteria | 3352 |
| 116 | Ga0466713_097230 | 3300042602 | Bacteria | 35407 |
| 117 | Ga0466713_149568 | 3300042602 | Bacteria | 40583 |
| 118 | Ga0466716_435570 | 3300042605 | Bacteria | 8745 |
| 119 | Ga0466719_567500 | 3300042606 | Bacteria | 2398 |
| 120 | 2227066912 | 2225789003 | Bacteria | 14668 |
| 121 | IMNBL1DRAFT_c0000571 | 3300000062 | Bacteria | 29765 |
| 122 | JGI24702J35022_10000313 | 3300002462 | Bacteria | 28772 |
| 123 | JGI24705J35276_12238471 | 3300002504 | Bacteria | 23366 |
| 124 | JGI24696J40584_12951226 | 3300002834 | Bacteria | 2221 |
| 125 | Ga0068302_10015324 | 3300005071 | Unclassified | 4123 |
| 126 | Ga0466729_230146 | 3300042621 | Bacteria | 3544 |
| 127 | Ga0466735_033114 | 3300042624 | Bacteria | 8684 |
| 128 | Ga0466704_456525 | 3300042643 | Bacteria | 16267 |
| 129 | Ga0466708_159225 | 3300042652 | Bacteria | 17626 |
| 130 | Ga0466725_296708 | 3300042654 | Bacteria | 33697 |
| 131 | Ga0466690_130894 | 3300042590 | Bacteria | 46975 |
| 132 | Ga0466692_046888 | 3300042591 | Bacteria | 170448 |
| 133 | Ga0466691_119361 | 3300042593 | Bacteria | 2979 |
| 134 | Ga0466691_152782 | 3300042593 | Bacteria | 8432 |
| 135 | Ga0466701_008700 | 3300042598 | Bacteria | 2394 |
| 136 | Ga0123357_10274792 | 3300009784 | Bacteria | 1753 |
| 137 | Ga0466705_031411 | 3300042612 | Bacteria | 3114 |
| 138 | Ga0466705_096350 | 3300042612 | Bacteria | 1185 |
| 139 | Ga0466732_091340 | 3300042656 | Bacteria | 2064 |
| 140 | Ga0466733_023891 | 3300042659 | Bacteria | 1027 |
| 141 | Ga0466733_170460 | 3300042659 | Bacteria | 186955 |
| 142 | Ga0466705_453940 | 3300042612 | Bacteria | 24913 |
| 143 | Ga0466711_367516 | 3300042615 | Bacteria | 42534 |
| 144 | Ga0466723_166754 | 3300042618 | Bacteria | 21656 |
| 145 | Ga0466726_160970 | 3300042619 | Bacteria | 3447 |
| 146 | Ga0466728_373770 | 3300042620 | Bacteria | 1647 |
| 147 | Ga0466728_444703 | 3300042620 | Bacteria | 9461 |
| 148 | Ga0466706_197953 | 3300042599 | Bacteria | 6388 |
| 149 | Ga0466706_221735 | 3300042599 | Bacteria | 9281 |
| 150 | Ga0466700_217257 | 3300042600 | Bacteria | 2036 |
| 151 | Ga0466700_397610 | 3300042600 | Bacteria | 1249 |
| 152 | Ga0466707_020809 | 3300042601 | Bacteria | 4408 |
| 153 | Ga0466707_125300 | 3300042601 | Bacteria | 5909 |
| 154 | Ga0466713_011886 | 3300042602 | Bacteria | 7053 |
| 155 | Ga0466713_038022 | 3300042602 | Bacteria | 17743 |
| 156 | Ga0466716_358293 | 3300042605 | Bacteria | 5763 |
| 157 | 2227311343 | 2225789004 | Bacteria | 6521 |
| 158 | IMNBL1DRAFT_c0001433 | 3300000062 | Bacteria | 17845 |
| 159 | JGI24702J35022_10011721 | 3300002462 | Bacteria | 4886 |
| 160 | Ga0068302_10187340 | 3300005071 | Bacteria | 1211 |
| 161 | Ga0068302_10556528 | 3300005071 | Bacteria | 1476 |
| 162 | Ga0068305_10008336 | 3300005083 | Bacteria | 9193 |
| 163 | Ga0466735_007322 | 3300042624 | Bacteria | 1192 |
| 164 | Ga0466703_164192 | 3300042636 | Bacteria | 11383 |
| 165 | Ga0466704_047995 | 3300042643 | Bacteria | 14309 |
| 166 | Ga0466709_205267 | 3300042648 | Bacteria | 11821 |
| 167 | Ga0466727_146516 | 3300042655 | Bacteria | 5683 |
| 168 | Ga0466690_014710 | 3300042590 | Bacteria | 16814 |
| 169 | Ga0466690_137345 | 3300042590 | Bacteria | 10902 |
| 170 | Ga0466692_037359 | 3300042591 | Bacteria | 23412 |
| 171 | Ga0466694_296218 | 3300042594 | Bacteria | 1400 |
| 172 | Ga0466705_220212 | 3300042612 | Bacteria | 8068 |
| 173 | Ga0466733_121822 | 3300042659 | Bacteria | 48145 |
| 174 | Ga0466711_204856 | 3300042615 | Bacteria | 25095 |
| 175 | Ga0466711_475336 | 3300042615 | Bacteria | 8276 |
| 176 | Ga0466715_246107 | 3300042616 | Bacteria | 6028 |
| 177 | Ga0466723_090241 | 3300042618 | Bacteria | 6281 |
| 178 | Ga0466726_087078 | 3300042619 | Bacteria | 9193 |
| 179 | Ga0466726_456797 | 3300042619 | Bacteria | 1778 |
| 180 | Ga0466728_247329 | 3300042620 | Bacteria | 15985 |
| 181 | Ga0466706_019673 | 3300042599 | Bacteria | 26134 |
| 182 | Ga0466706_152962 | 3300042599 | Bacteria | 9363 |
| 183 | Ga0466706_207960 | 3300042599 | Bacteria | 11409 |
| 184 | Ga0466716_260414 | 3300042605 | Bacteria | 24668 |
| 185 | Ga0466719_225658 | 3300042606 | Bacteria | 39861 |
| 186 | Ga0466722_018264 | 3300042609 | Bacteria | 20663 |
| 187 | IMNBL1DRAFT_c0021764 | 3300000062 | Bacteria | 2556 |
| 188 | JGI24702J35022_10002783 | 3300002462 | Bacteria | 10613 |
| 189 | JGI24702J35022_10045881 | 3300002462 | Bacteria | 2328 |
| 190 | Ga0068305_10301764 | 3300005083 | Bacteria | 993 |
| 191 | Ga0466703_395550 | 3300042636 | Bacteria | 5779 |
| 192 | Ga0466704_104362 | 3300042643 | Bacteria | 17885 |
| 193 | Ga0466709_089231 | 3300042648 | Bacteria | 2107 |
| 194 | Ga0160472_100024 | 3300012839 | Bacteria | 325454 |
| 195 | Ga0466657_298773 | 3300042582 | Bacteria | 1443 |
| 196 | Ga0466690_117527 | 3300042590 | Bacteria | 6771 |
| 197 | Ga0466696_245383 | 3300042596 | Bacteria | 3531 |
| 198 | Ga0466696_486564 | 3300042596 | Bacteria | 1148 |
| 199 | Ga0123357_10010668 | 3300009784 | Bacteria | 11709 |
| 200 | Ga0123356_10068879 | 3300010049 | Bacteria | 3317 |
| 201 | Ga0466711_084970 | 3300042615 | Bacteria | 9199 |
| 202 | Ga0466715_254454 | 3300042616 | Bacteria | 18603 |
| 203 | Ga0466723_202724 | 3300042618 | Bacteria | 15060 |
| 204 | Ga0466728_365747 | 3300042620 | Bacteria | 5250 |
| 205 | Ga0466728_436063 | 3300042620 | Bacteria | 24967 |
| 206 | Ga0466706_035124 | 3300042599 | Bacteria | 61315 |
| 207 | Ga0466706_145326 | 3300042599 | Bacteria | 17959 |
| 208 | Ga0466706_200718 | 3300042599 | Bacteria | 2557 |
| 209 | Ga0466707_305271 | 3300042601 | Bacteria | 2184 |
| 210 | Ga0466716_270209 | 3300042605 | Bacteria | 4777 |
| 211 | 2227358579 | 2225789004 | Bacteria | 27873 |
| 212 | IMNBL1DRAFT_c0004389 | 3300000062 | Bacteria | 8511 |
| 213 | IMNBL1DRAFT_c0005848 | 3300000062 | Bacteria | 6899 |
| 214 | Ga0466729_266796 | 3300042621 | Bacteria | 6885 |
| 215 | Ga0466734_017147 | 3300042623 | Bacteria | 1490 |
| 216 | Ga0466735_206142 | 3300042624 | Bacteria | 1510 |
| 217 | Ga0466703_292687 | 3300042636 | Bacteria | 2780 |
| 218 | Ga0466709_139700 | 3300042648 | Bacteria | 8917 |
| 219 | Ga0466708_029214 | 3300042652 | Bacteria | 82759 |
| 220 | Ga0466691_154541 | 3300042593 | Bacteria | 15117 |
| 221 | Ga0466696_177348 | 3300042596 | Bacteria | 14013 |
| 222 | Ga0466696_241627 | 3300042596 | Bacteria | 18100 |
| 223 | Ga0466696_386210 | 3300042596 | Unclassified | 12674 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01048 | PNP_UDP_1 | Phosphorylase superfamily | 65 | 304 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.