Protein Family IF05103
Metagenome
Isolate
214
Members
81
Samples
184
Scaffolds
386.02
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_033403|Ga0466696_033403_636_1868
- Length
- 410 aa
- Sequence
- MFALKPVKLVMNTDNSTYNFDDIRPLNDNEVRDAIESLLRSADFRSALRYIMPDLDWEEFANAMRRCKTKSQFKTTLAYNAVIQIAKMTTFSLTISGRSRAPRETIPCTFISNHRDIVLDAAFLNVLLFEIGREMTQVAIGDNLLIHPWIDTLVRLNNCFIVKRALSVRQLLEASRQLSAYIHHTIKRSGESIWIAQREGRAKDSNDHTQSSILKMLNMAGDDKDSILKNLMSLNIVPIAISYEHDPCDYLKAKEFQQKRDDSDFVKSKRDDLLNMETGLLNNKGRVHFTIGSPINDKLARLEYKKSDRNALIAAIAEIIDKEIYKHYRFYPCNYVAYDLLHHSVYFRTNYDLRDKMLFETYLQKQIDKIDLPNKDERFLRTKILEMYSNPLQNHLDNVGQTTSNGEDGE
Sample Types
Isolate
14.0%
Metagenome
86.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
33.8%
Termitidae
27.5%
Kalotermitidae
17.5%
Unclassified
6.2%
Rhinotermitidae
5.0%
Termopsidae
5.0%
Passalidae
3.8%
Hodotermitidae
1.2%
Taxonomy
Archaea
0
Bacteria
209
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 2 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 3 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 4 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 5 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 13 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 20 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 21 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 22 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 23 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 28 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 29 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 30 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 31 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 32 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 33 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 34 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 35 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 36 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 37 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 43 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 44 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 45 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 46 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 47 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 48 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 49 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 50 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 51 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 52 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 53 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 54 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 55 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 56 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 57 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 58 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 59 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 60 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 61 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 62 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 63 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 64 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 65 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 66 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 67 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 68 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 69 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 70 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 71 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 72 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 73 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 74 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 75 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 76 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 77 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 78 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 79 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 80 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 81 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_119312 | 3300042612 | Bacteria | 10871 |
| 2 | IMNBL1DRAFT_c0002430 | 3300000062 | Bacteria | 12970 |
| 3 | IMNBL1DRAFT_c0004630 | 3300000062 | Bacteria | 8182 |
| 4 | IMNBL1DRAFT_c0006767 | 3300000062 | Bacteria | 6188 |
| 5 | JGI24702J35022_10000052 | 3300002462 | Bacteria | 49045 |
| 6 | JGI24702J35022_10035083 | 3300002462 | Bacteria | 2683 |
| 7 | Ga0068305_10058805 | 3300005083 | Bacteria | 8168 |
| 8 | Ga0123356_10060808 | 3300010049 | Bacteria | 3526 |
| 9 | Ga0123356_10097015 | 3300010049 | Bacteria | 2820 |
| 10 | Ga0123353_10243962 | 3300010167 | Bacteria | 2789 |
| 11 | Ga0466735_087403 | 3300042624 | Bacteria | 2503 |
| 12 | Ga0466704_230455 | 3300042643 | Bacteria | 5728 |
| 13 | Ga0466704_230588 | 3300042643 | Bacteria | 2605 |
| 14 | Ga0466704_272694 | 3300042643 | Bacteria | 11548 |
| 15 | Ga0466704_556669 | 3300042643 | Bacteria | 7941 |
| 16 | Ga0466725_021276 | 3300042654 | Bacteria | 24418 |
| 17 | Ga0466706_156084 | 3300042599 | Bacteria | 15343 |
| 18 | Ga0466707_312039 | 3300042601 | Bacteria | 9254 |
| 19 | Ga0466713_061704 | 3300042602 | Bacteria | 58940 |
| 20 | Ga0466714_050034 | 3300042603 | Bacteria | 52077 |
| 21 | Ga0466719_072882 | 3300042606 | Bacteria | 12516 |
| 22 | Ga0466705_005120 | 3300042612 | Bacteria | 3934 |
| 23 | Ga0466733_030455 | 3300042659 | Bacteria | 39544 |
| 24 | IMNBL1DRAFT_c0006180 | 3300000062 | Bacteria | 6604 |
| 25 | JGI24705J35276_12238770 | 3300002504 | Bacteria | 57808 |
| 26 | JGI24699J35502_11131956 | 3300002509 | Bacteria | 6213 |
| 27 | Ga0072940_1369425 | 3300005200 | Bacteria | 1670 |
| 28 | Ga0466735_063936 | 3300042624 | Bacteria | 5662 |
| 29 | Ga0466735_175797 | 3300042624 | Bacteria | 2786 |
| 30 | Ga0466704_228006 | 3300042643 | Bacteria | 10392 |
| 31 | Ga0466725_205673 | 3300042654 | Bacteria | 4900 |
| 32 | Ga0466727_001589 | 3300042655 | Bacteria | 4634 |
| 33 | Ga0466710_247932 | 3300042613 | Bacteria | 1908 |
| 34 | Ga0466723_059005 | 3300042618 | Bacteria | 62633 |
| 35 | Ga0466728_399396 | 3300042620 | Bacteria | 7766 |
| 36 | Ga0466729_089960 | 3300042621 | Bacteria | 9721 |
| 37 | Ga0466693_373242 | 3300042592 | Bacteria | 1950 |
| 38 | Ga0466695_155412 | 3300042595 | Bacteria | 5015 |
| 39 | Ga0466707_265105 | 3300042601 | Bacteria | 17266 |
| 40 | Ga0466713_143155 | 3300042602 | Bacteria | 188721 |
| 41 | Ga0466714_034472 | 3300042603 | Bacteria | 3587 |
| 42 | Ga0466716_023288 | 3300042605 | Bacteria | 6855 |
| 43 | Ga0466733_078806 | 3300042659 | Bacteria | 7143 |
| 44 | Ga0466733_081782 | 3300042659 | Bacteria | 22829 |
| 45 | 2227261351 | 2225789004 | Bacteria | 7006 |
| 46 | Ga0068302_10168767 | 3300005071 | Bacteria | 3729 |
| 47 | Ga0123353_10156837 | 3300010167 | Bacteria | 3627 |
| 48 | Ga0466735_042391 | 3300042624 | Bacteria | 2353 |
| 49 | Ga0466704_100291 | 3300042643 | Bacteria | 27866 |
| 50 | Ga0466704_106814 | 3300042643 | Bacteria | 18291 |
| 51 | Ga0466724_41607 | 3300042649 | Bacteria | 1531 |
| 52 | Ga0466715_056557 | 3300042616 | Bacteria | 7288 |
| 53 | Ga0466715_118092 | 3300042616 | Bacteria | 13081 |
| 54 | Ga0466726_311948 | 3300042619 | Bacteria | 5377 |
| 55 | Ga0466690_037512 | 3300042590 | Bacteria | 4211 |
| 56 | Ga0466692_155733 | 3300042591 | Bacteria | 3425 |
| 57 | Ga0466691_060692 | 3300042593 | Bacteria | 22870 |
| 58 | Ga0466696_033403 | 3300042596 | Bacteria | 5157 |
| 59 | Ga0466696_077671 | 3300042596 | Bacteria | 18917 |
| 60 | Ga0466696_164484 | 3300042596 | Bacteria | 3472 |
| 61 | Ga0466706_179743 | 3300042599 | Bacteria | 3206 |
| 62 | Ga0466714_016102 | 3300042603 | Bacteria | 35564 |
| 63 | Ga0466719_113132 | 3300042606 | Bacteria | 2524 |
| 64 | Ga0466705_025497 | 3300042612 | Bacteria | 5436 |
| 65 | Ga0466705_029661 | 3300042612 | Bacteria | 15539 |
| 66 | Ga0466705_350213 | 3300042612 | Bacteria | 6932 |
| 67 | Ga0466733_019214 | 3300042659 | Bacteria | 126944 |
| 68 | JGI24702J35022_10008385 | 3300002462 | Bacteria | 5851 |
| 69 | JGI24696J40584_12961200 | 3300002834 | Bacteria | 11946 |
| 70 | Ga0068302_10519094 | 3300005071 | Bacteria | 2089 |
| 71 | Ga0068305_10220623 | 3300005083 | Bacteria | 1555 |
| 72 | Ga0466735_054151 | 3300042624 | Bacteria | 3594 |
| 73 | Ga0466709_305019 | 3300042648 | Bacteria | 2983 |
| 74 | Ga0466711_061436 | 3300042615 | Bacteria | 1150 |
| 75 | Ga0466711_263178 | 3300042615 | Bacteria | 12410 |
| 76 | Ga0466715_080963 | 3300042616 | Bacteria | 6536 |
| 77 | Ga0466715_109224 | 3300042616 | Bacteria | 75833 |
| 78 | Ga0466723_031578 | 3300042618 | Bacteria | 25603 |
| 79 | Ga0466693_235215 | 3300042592 | Bacteria | 1585 |
| 80 | Ga0466696_216658 | 3300042596 | Bacteria | 10942 |
| 81 | Ga0466696_288691 | 3300042596 | Bacteria | 66943 |
| 82 | Ga0466700_005502 | 3300042600 | Bacteria | 2038 |
| 83 | Ga0466707_168419 | 3300042601 | Bacteria | 12239 |
| 84 | Ga0466713_037297 | 3300042602 | Bacteria | 10325 |
| 85 | Ga0466713_048054 | 3300042602 | Bacteria | 2648 |
| 86 | Ga0466714_006756 | 3300042603 | Bacteria | 211810 |
| 87 | Ga0466716_015499 | 3300042605 | Bacteria | 12805 |
| 88 | Ga0466722_021094 | 3300042609 | Bacteria | 6705 |
| 89 | Ga0466722_022507 | 3300042609 | Bacteria | 12182 |
| 90 | 2227069681 | 2225789003 | Bacteria | 13597 |
| 91 | 2227280803 | 2225789004 | Bacteria | 6812 |
| 92 | JGI24702J35022_10006117 | 3300002462 | Bacteria | 6986 |
| 93 | Ga0466735_080453 | 3300042624 | Bacteria | 2631 |
| 94 | Ga0466703_174239 | 3300042636 | Bacteria | 11289 |
| 95 | Ga0466709_096536 | 3300042648 | Bacteria | 31729 |
| 96 | Ga0466710_206891 | 3300042613 | Bacteria | 2667 |
| 97 | Ga0466715_043219 | 3300042616 | Bacteria | 25123 |
| 98 | Ga0466728_391319 | 3300042620 | Bacteria | 47879 |
| 99 | Ga0466694_211572 | 3300042594 | Bacteria | 1793 |
| 100 | Ga0466700_103876 | 3300042600 | Bacteria | 3235 |
| 101 | Ga0466707_111993 | 3300042601 | Bacteria | 11357 |
| 102 | Ga0466707_224834 | 3300042601 | Bacteria | 36207 |
| 103 | Ga0466713_022498 | 3300042602 | Bacteria | 83235 |
| 104 | Ga0466714_046181 | 3300042603 | Bacteria | 4010 |
| 105 | Ga0466716_175138 | 3300042605 | Bacteria | 7946 |
| 106 | Ga0466716_434229 | 3300042605 | Bacteria | 25603 |
| 107 | Ga0466722_254598 | 3300042609 | Bacteria | 13326 |
| 108 | Ga0466705_143850 | 3300042612 | Bacteria | 38978 |
| 109 | Ga0466733_119479 | 3300042659 | Unclassified | 3875 |
| 110 | JGI24702J35022_10036670 | 3300002462 | Bacteria | 2620 |
| 111 | Ga0068305_10074356 | 3300005083 | Bacteria | 7825 |
| 112 | Ga0466703_101237 | 3300042636 | Bacteria | 13083 |
| 113 | Ga0466703_165459 | 3300042636 | Bacteria | 12745 |
| 114 | Ga0466703_177352 | 3300042636 | Bacteria | 30164 |
| 115 | Ga0466703_253790 | 3300042636 | Bacteria | 12991 |
| 116 | Ga0466704_035232 | 3300042643 | Bacteria | 3094 |
| 117 | Ga0466704_236040 | 3300042643 | Bacteria | 23395 |
| 118 | Ga0466727_023845 | 3300042655 | Bacteria | 16909 |
| 119 | Ga0466727_265103 | 3300042655 | Bacteria | 3692 |
| 120 | Ga0466711_298539 | 3300042615 | Bacteria | 5772 |
| 121 | Ga0466715_066831 | 3300042616 | Bacteria | 11732 |
| 122 | Ga0466729_095620 | 3300042621 | Bacteria | 5430 |
| 123 | Ga0466690_077926 | 3300042590 | Bacteria | 4747 |
| 124 | Ga0466690_172738 | 3300042590 | Bacteria | 57212 |
| 125 | Ga0466693_055865 | 3300042592 | Bacteria | 2634 |
| 126 | Ga0466696_043446 | 3300042596 | Bacteria | 10091 |
| 127 | Ga0466696_198573 | 3300042596 | Unclassified | 3746 |
| 128 | Ga0466696_323500 | 3300042596 | Bacteria | 24747 |
| 129 | Ga0466696_489357 | 3300042596 | Bacteria | 8948 |
| 130 | Ga0466699_358518 | 3300042597 | Bacteria | 2031 |
| 131 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 132 | Ga0466719_186573 | 3300042606 | Bacteria | 15608 |
| 133 | Ga0466722_204921 | 3300042609 | Bacteria | 21464 |
| 134 | Ga0466705_078038 | 3300042612 | Bacteria | 10688 |
| 135 | Ga0466733_055799 | 3300042659 | Bacteria | 106016 |
| 136 | IMNBL1DRAFT_c0007061 | 3300000062 | Bacteria | 5983 |
| 137 | IMNBL1DRAFT_c0017657 | 3300000062 | Unclassified | 2992 |
| 138 | JGI24702J35022_10030978 | 3300002462 | Bacteria | 2868 |
| 139 | JGI24702J35022_10140269 | 3300002462 | Bacteria | 1348 |
| 140 | Ga0068302_10086754 | 3300005071 | Unclassified | 5793 |
| 141 | Ga0072941_1437251 | 3300005201 | Bacteria | 1585 |
| 142 | Ga0123354_10000565 | 3300010882 | Bacteria | 38228 |
| 143 | Ga0466731_310822 | 3300042622 | Bacteria | 3222 |
| 144 | Ga0466730_011350 | 3300042625 | Bacteria | 3523 |
| 145 | Ga0466704_283483 | 3300042643 | Bacteria | 4787 |
| 146 | Ga0466710_240323 | 3300042613 | Bacteria | 19088 |
| 147 | Ga0466715_015022 | 3300042616 | Bacteria | 20053 |
| 148 | Ga0466718_142578 | 3300042617 | Bacteria | 1935 |
| 149 | Ga0466726_001708 | 3300042619 | Bacteria | 2117 |
| 150 | Ga0466728_142087 | 3300042620 | Bacteria | 16905 |
| 151 | Ga0466656_218669 | 3300042550 | Bacteria | 33170 |
| 152 | Ga0466690_226779 | 3300042590 | Bacteria | 21131 |
| 153 | Ga0466690_342711 | 3300042590 | Bacteria | 6247 |
| 154 | Ga0466691_124508 | 3300042593 | Bacteria | 35460 |
| 155 | Ga0466706_264655 | 3300042599 | Bacteria | 11685 |
| 156 | Ga0466707_050302 | 3300042601 | Bacteria | 3601 |
| 157 | Ga0466713_024971 | 3300042602 | Bacteria | 11465 |
| 158 | Ga0466719_036510 | 3300042606 | Bacteria | 25328 |
| 159 | Ga0466722_117304 | 3300042609 | Bacteria | 122884 |
| 160 | Ga0466733_203254 | 3300042659 | Bacteria | 17585 |
| 161 | 2227153022 | 2225789004 | Bacteria | 8525 |
| 162 | 2227557978 | 2225789004 | Bacteria | 2760 |
| 163 | JGI24702J35022_10035077 | 3300002462 | Bacteria | 2683 |
| 164 | Ga0072941_1644237 | 3300005201 | Bacteria | 2692 |
| 165 | Ga0466703_098605 | 3300042636 | Bacteria | 6901 |
| 166 | Ga0466703_151143 | 3300042636 | Bacteria | 15053 |
| 167 | Ga0466703_164140 | 3300042636 | Bacteria | 13651 |
| 168 | Ga0466704_241136 | 3300042643 | Bacteria | 12160 |
| 169 | Ga0466709_026484 | 3300042648 | Unclassified | 13139 |
| 170 | Ga0466708_171823 | 3300042652 | Bacteria | 8339 |
| 171 | Ga0466725_061742 | 3300042654 | Bacteria | 7539 |
| 172 | Ga0466727_008747 | 3300042655 | Bacteria | 11688 |
| 173 | Ga0466711_241851 | 3300042615 | Bacteria | 11602 |
| 174 | Ga0466715_017736 | 3300042616 | Bacteria | 12115 |
| 175 | Ga0466723_199680 | 3300042618 | Bacteria | 21029 |
| 176 | Ga0466723_223624 | 3300042618 | Bacteria | 21568 |
| 177 | Ga0466726_072101 | 3300042619 | Bacteria | 6736 |
| 178 | Ga0466692_050403 | 3300042591 | Bacteria | 54496 |
| 179 | Ga0466691_049926 | 3300042593 | Bacteria | 11408 |
| 180 | Ga0466696_124796 | 3300042596 | Bacteria | 1738 |
| 181 | Ga0466696_322323 | 3300042596 | Bacteria | 4419 |
| 182 | Ga0466713_020955 | 3300042602 | Bacteria | 68417 |
| 183 | Ga0466713_156458 | 3300042602 | Bacteria | 4963 |
| 184 | Ga0466716_121228 | 3300042605 | Bacteria | 19334 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01553 | Acyltransferase | Acyltransferase | 96 | 205 | 0.72 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01553 | GO:0016746 | acyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.