Protein Family IF05077

Metagenome Isolate
202 Members
45 Samples
191 Scaffolds
119.97 Avg Length

🧬 Representative Sequence

ID
3300042595|Ga0466695_230149|Ga0466695_230149_246_620
Length
124 aa
Sequence
MKQKVPICDCEVIHEAVVKRVRKVMPKDEDFYDLADLYKMFADSTRVRILWALSAAADVAGQEMCVCDIAVLLDMTKSAISHQLKSLRLANLVKYYKRGKEVYYSLADSHVKDIFEKGFEHIHE

📊 Sample Types

Isolate 5.5%
Metagenome 94.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 54.8%
Unclassified 28.6%
Kalotermitidae 7.1%
Rhinotermitidae 2.4%
Hodotermitidae 2.4%
Termopsidae 2.4%
Passalidae 2.4%

🌳 Taxonomy

Archaea 8
Bacteria 151
Eukaryota 0
Viruses 0
Unclassified 43

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
12 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
13 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
14 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
15 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
16 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
17 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
18 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
19 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
20 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
21 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
22 2819990093 Unclassified Spirochaetes Cu122P1bin9 Isolate Unclassified
23 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
24 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
25 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
26 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
27 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
28 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
29 2778260935 Unclassified Fibrobacteres Co191P1bin79 Isolate Unclassified
30 2778260938 Unclassified Fibrobacteres Co191P3bin71 Isolate Unclassified
31 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
34 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
35 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
36 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
37 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
38 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
39 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
40 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
41 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
42 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
43 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
44 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
45 3300005200 Nasutitermes gut metagenome Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_387677 3300042656 Bacteria 1062
2 Ga0466693_258216 3300042592 Bacteria 2141
3 Ga0466699_131420 3300042597 Bacteria 22068
4 Ga0466699_218156 3300042597 Bacteria 1507
5 Ga0466699_406881 3300042597 Bacteria 6833
6 Ga0466712_005397 3300042614 Bacteria 5528
7 Ga0466712_007703 3300042614 Bacteria 3828
8 Ga0466712_017147 3300042614 Bacteria 1120
9 Ga0466712_086932 3300042614 Bacteria 10706
10 Ga0466712_089302 3300042614 Bacteria 10221
11 Ga0466712_235568 3300042614 Bacteria 1914
12 Ga0123355_11564277 3300009826 Archaea 638
13 AustNasuHG_c1000274 3300000089 Bacteria 17692
14 JGI24698J34947_10005522 3300002449 Bacteria 6938
15 JGI24698J34947_10031687 3300002449 Bacteria 2781
16 JGI24698J34947_10034164 3300002449 Bacteria 2663
17 JGI24698J34947_10047733 3300002449 Unclassified 2172
18 JGI24695J34938_10010634 3300002450 Bacteria 5021
19 JGI24695J34938_10083064 3300002450 Archaea 1321
20 Ga0466720_012048 3300042607 Bacteria 1453
21 Ga0466720_111533 3300042607 Bacteria 18124
22 Ga0466720_127225 3300042607 Unclassified 1272
23 Ga0466720_137673 3300042607 Bacteria 11300
24 Ga0466720_218782 3300042607 Bacteria 30566
25 Ga0466720_222943 3300042607 Unclassified 2017
26 Ga0466702_075677 3300042635 Bacteria 5423
27 Ga0466702_198708 3300042635 Bacteria 1095
28 Ga0466694_192251 3300042594 Bacteria 1549
29 Ga0466699_118756 3300042597 Unclassified 3565
30 Ga0466699_176554 3300042597 Unclassified 2157
31 Ga0466699_359606 3300042597 Bacteria 9816
32 Ga0466699_361731 3300042597 Archaea 1025
33 Ga0466712_165976 3300042614 Bacteria 6828
34 Ga0466712_293940 3300042614 Bacteria 12794
35 Ga0466726_342517 3300042619 Bacteria 1285
36 Ga0123355_10441269 3300009826 Bacteria 1648
37 Ga0123353_10859742 3300010167 Unclassified 1242
38 Ga0123353_12719079 3300010167 Bacteria 582
39 JGI24698J34947_10003710 3300002449 Unclassified 8308
40 JGI24698J34947_10033279 3300002449 Unclassified 2705
41 JGI24698J34947_10104018 3300002449 Unclassified 1269
42 JGI24698J34947_10110268 3300002449 Unclassified 1216
43 JGI24695J34938_10056694 3300002450 Unclassified 1687
44 JGI24702J35022_10625488 3300002462 Bacteria 667
45 Ga0072940_1050147 3300005200 Bacteria 19092
46 Ga0072941_1023261 3300005201 Bacteria 6588
47 Ga0466706_226908 3300042599 Bacteria 2404
48 Ga0466720_069599 3300042607 Bacteria 5774
49 Ga0466720_230813 3300042607 Bacteria 1315
50 Ga0466702_283387 3300042635 Bacteria 1054
51 Ga0466732_085339 3300042656 Unclassified 1691
52 Ga0264413_100017 3300024493 Bacteria 16893
53 Ga0264413_100113 3300024493 Unclassified 1981
54 Ga0264413_109917 3300024493 Bacteria 6747
55 Ga0466712_014138 3300042614 Bacteria 1255
56 Ga0466712_121300 3300042614 Bacteria 1159
57 Ga0123355_10211884 3300009826 Bacteria 2806
58 IMNBL1DRAFT_c0011118 3300000062 Bacteria 4233
59 AustNasuHG_c1001232 3300000089 Bacteria 9205
60 FAAS_10002747 3300001880 Unclassified 1733
61 FAAS_10408126 3300001880 Bacteria 542
62 JGI24698J34947_10009890 3300002449 Bacteria 5229
63 JGI24698J34947_10043913 3300002449 Unclassified 2289
64 JGI24698J34947_10045065 3300002449 Unclassified 2254
65 JGI24698J34947_10050328 3300002449 Unclassified 2102
66 JGI24698J34947_10153167 3300002449 Unclassified 954
67 JGI24695J34938_10002305 3300002450 Bacteria 14716
68 JGI24695J34938_10012264 3300002450 Bacteria 4555
69 JGI24702J35022_10076756 3300002462 Bacteria 1806
70 JGI24696J40584_12791822 3300002834 Bacteria 854
71 Ga0068305_10002486 3300005083 Bacteria 3087
72 Ga0072941_1007497 3300005201 Bacteria 6393
73 Ga0466720_154299 3300042607 Bacteria 16533
74 Ga0466698_128609 3300042610 Bacteria 7282
75 Ga0466732_094302 3300042656 Bacteria 6089
76 Ga0466732_360471 3300042656 Unclassified 2341
77 Ga0264413_114774 3300024493 Unclassified 19217
78 Ga0466692_061217 3300042591 Bacteria 34862
79 Ga0466693_296717 3300042592 Unclassified 1665
80 Ga0466696_069647 3300042596 Bacteria 1699
81 Ga0466699_250291 3300042597 Bacteria 49857
82 Ga0466712_011198 3300042614 Bacteria 4934
83 Ga0466712_226974 3300042614 Bacteria 15361
84 Ga0466712_242026 3300042614 Bacteria 4469
85 Ga0123353_10229648 3300010167 Bacteria 2894
86 Ga0123353_12174390 3300010167 Archaea 672
87 AustNasuHG_c1000547 3300000089 Bacteria 13225
88 JGI24695J34938_10002881 3300002450 Bacteria 12532
89 JGI24695J34938_10098188 3300002450 Bacteria 1198
90 Ga0072940_1011944 3300005200 Bacteria 2308
91 Ga0072941_1119368 3300005201 Unclassified 2611
92 Ga0466719_396779 3300042606 Bacteria 1600
93 Ga0466720_015041 3300042607 Unclassified 6696
94 Ga0466720_110674 3300042607 Unclassified 1143
95 Ga0466702_255401 3300042635 Bacteria 1318
96 Ga0466703_237609 3300042636 Bacteria 2214
97 Ga0466732_385741 3300042656 Bacteria 3546
98 Ga0466693_198148 3300042592 Unclassified 1505
99 Ga0466699_029046 3300042597 Bacteria 6713
100 Ga0466712_047164 3300042614 Bacteria 13140
101 Ga0466712_109354 3300042614 Bacteria 8362
102 Ga0466712_284237 3300042614 Bacteria 8418
103 Ga0466718_094528 3300042617 Unclassified 5720
104 Ga0466718_110619 3300042617 Bacteria 29824
105 Ga0123353_10978778 3300010167 Bacteria 1140
106 2230955456 2228664003 Archaea 752
107 IMNBL1DRAFT_c0004380 3300000062 Bacteria 8518
108 AustNasuHG_c1021779 3300000089 Unclassified 2069
109 AustNasuHG_c1056355 3300000089 Unclassified 792
110 JGI24698J34947_10001368 3300002449 Bacteria 12822
111 JGI24695J34938_10000281 3300002450 Bacteria 50109
112 JGI24695J34938_10026278 3300002450 Bacteria 2769
113 JGI24695J34938_10058393 3300002450 Archaea 1655
114 Ga0072941_1007747 3300005201 Unclassified 12477
115 Ga0466700_219354 3300042600 Bacteria 1104
116 Ga0466720_046734 3300042607 Bacteria 5443
117 Ga0466698_022701 3300042610 Bacteria 11044
118 Ga0466698_135203 3300042610 Bacteria 2996
119 Ga0466732_010438 3300042656 Unclassified 1656
120 Ga0466692_064520 3300042591 Bacteria 2459
121 Ga0466693_095458 3300042592 Unclassified 6071
122 Ga0466694_344037 3300042594 Bacteria 2117
123 Ga0466695_366621 3300042595 Bacteria 6271
124 Ga0466699_286684 3300042597 Bacteria 1247
125 Ga0466699_433575 3300042597 Bacteria 3640
126 Ga0466699_442490 3300042597 Bacteria 1527
127 Ga0466712_007873 3300042614 Bacteria 5732
128 Ga0466712_080658 3300042614 Archaea 2406
129 Ga0466712_163505 3300042614 Bacteria 2733
130 Ga0466712_171711 3300042614 Bacteria 4037
131 IMNBL1DRAFT_c0096613 3300000062 Bacteria 801
132 JGI24698J34947_10002453 3300002449 Bacteria 9995
133 JGI24698J34947_10008983 3300002449 Unclassified 5480
134 JGI24698J34947_10044859 3300002449 Unclassified 2260
135 JGI24698J34947_10047284 3300002449 Bacteria 2184
136 JGI24698J34947_10056407 3300002449 Unclassified 1953
137 JGI24695J34938_10003040 3300002450 Bacteria 12033
138 JGI24695J34938_10007809 3300002450 Bacteria 6199
139 Ga0072941_1020216 3300005201 Bacteria 13763
140 Ga0072941_1044500 3300005201 Bacteria 9988
141 Ga0072941_1057784 3300005201 Bacteria 2883
142 Ga0466720_021688 3300042607 Bacteria 3890
143 Ga0466702_460088 3300042635 Bacteria 1271
144 Ga0264413_127018 3300024493 Unclassified 3634
145 Ga0466694_066700 3300042594 Unclassified 3598
146 Ga0466694_272362 3300042594 Archaea 1052
147 Ga0466699_063153 3300042597 Bacteria 1646
148 Ga0466699_077243 3300042597 Bacteria 1085
149 Ga0466699_208848 3300042597 Bacteria 3986
150 Ga0466699_313318 3300042597 Unclassified 1674
151 Ga0466712_090336 3300042614 Bacteria 5928
152 Ga0466718_034411 3300042617 Bacteria 10650
153 Ga0466718_143502 3300042617 Bacteria 12282
154 Ga0123356_11297485 3300010049 Unclassified 891
155 JGI24698J34947_10001974 3300002449 Bacteria 10950
156 JGI24698J34947_10002710 3300002449 Bacteria 9565
157 JGI24698J34947_10005707 3300002449 Bacteria 6826
158 JGI24698J34947_10007119 3300002449 Bacteria 6145
159 JGI24698J34947_10014185 3300002449 Bacteria 4338
160 JGI24698J34947_10093593 3300002449 Bacteria 1371
161 JGI24695J34938_10000235 3300002450 Bacteria 52917
162 JGI24695J34938_10003452 3300002450 Bacteria 11037
163 JGI24697J35500_11234643 3300002507 Unclassified 2101
164 JGI24699J35502_10609375 3300002509 Bacteria 689
165 Ga0072941_1002942 3300005201 Bacteria 34025
166 Ga0466702_449492 3300042635 Bacteria 10647
167 Ga0466703_287406 3300042636 Bacteria 1183
168 Ga0466732_170568 3300042656 Bacteria 3649
169 Ga0264413_100114 3300024493 Unclassified 2268
170 Ga0264413_103185 3300024493 Bacteria 7198
171 Ga0466693_107082 3300042592 Bacteria 4970
172 Ga0466694_022561 3300042594 Bacteria 1101
173 Ga0466695_230149 3300042595 Bacteria 1231
174 Ga0466699_150659 3300042597 Bacteria 5552
175 Ga0466699_367620 3300042597 Bacteria 1090
176 Ga0466712_057930 3300042614 Bacteria 1408
177 Ga0466712_105734 3300042614 Bacteria 7334
178 Ga0466712_271950 3300042614 Bacteria 20534
179 Ga0466718_088591 3300042617 Bacteria 9040
180 Ga0123353_10086080 3300010167 Bacteria 5061
181 JGI24698J34947_10033773 3300002449 Unclassified 2681
182 JGI24698J34947_10109556 3300002449 Bacteria 1222
183 JGI24698J34947_10166495 3300002449 Bacteria 897
184 JGI24702J35022_10935469 3300002462 Bacteria 540
185 JGI24696J40584_12954393 3300002834 Unclassified 2629
186 Ga0072941_1157668 3300005201 Unclassified 1332
187 Ga0466720_144023 3300042607 Bacteria 21010
188 Ga0466720_177926 3300042607 Bacteria 14457
189 Ga0466720_211590 3300042607 Bacteria 23388
190 Ga0466702_101174 3300042635 Bacteria 2004
191 Ga0466702_410678 3300042635 Bacteria 1067

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12840 HTH_20 Helix-turn-helix domain 41 94 0.97
PF01022 HTH_5 Bacterial regulatory protein, arsR family 43 95 0.96

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.