Protein Family IF05061
Metagenome
Isolate
124
Members
50
Samples
117
Scaffolds
277.41
Avg Length
Representative Sequence
- ID
- 3300042595|Ga0466695_006285|Ga0466695_006285_2105_3019
- Length
- 304 aa
- Sequence
- VLNSNLKTINCQGRLLSLEDPLVMGILNITPDSFSDGGQFWHEKDALNHCEKMLNEGAEIIDIGAVSTKPFADDVSLEEEKKRLQNILPTLVKTFPHAIFSVDTFRSEIARMAVSEGASIINDISGGQADEHMFKTIGELQVPYVMMHTQGMPQTMQVEPKYDDVMNELIVFFAKQIASAHQAGVLDIIVDPGFGFGKNLEHNYEILGRLERFQILEKPIMVGFSKKSMIRNLLEVDIENSLNGTTVTNTVALLKGANILRVHDVKEAVEAVKIIKKCYSERSEESVSKQILRYAQDDNLKSKT
Sample Types
Isolate
5.7%
Metagenome
94.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Kalotermitidae
27.1%
Unclassified
16.7%
Rhinotermitidae
6.2%
Termopsidae
6.2%
Passalidae
4.2%
Drosophilidae
4.2%
Blattidae
2.1%
Taxonomy
Archaea
0
Bacteria
121
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 2 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 11 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 12 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 13 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 14 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 15 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 16 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 25 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 32 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 33 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 38 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 39 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 40 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 41 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 42 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 43 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 44 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 46 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 48 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 49 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 50 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10188323 | 3300009784 | Bacteria | 2386 |
| 2 | Ga0123355_10003374 | 3300009826 | Bacteria | 22877 |
| 3 | Ga0123354_10003821 | 3300010882 | Bacteria | 21020 |
| 4 | Ga0466657_039962 | 3300042582 | Bacteria | 3790 |
| 5 | Ga0466690_273332 | 3300042590 | Bacteria | 9975 |
| 6 | Ga0466692_106596 | 3300042591 | Bacteria | 5339 |
| 7 | JGI24695J34938_10143035 | 3300002450 | Bacteria | 977 |
| 8 | Ga0466700_225509 | 3300042600 | Bacteria | 7762 |
| 9 | Ga0466700_323124 | 3300042600 | Bacteria | 1631 |
| 10 | Ga0466707_334151 | 3300042601 | Bacteria | 5990 |
| 11 | Ga0466722_203151 | 3300042609 | Bacteria | 4859 |
| 12 | Ga0466734_161798 | 3300042623 | Bacteria | 1212 |
| 13 | Ga0466735_053970 | 3300042624 | Bacteria | 4186 |
| 14 | Ga0466704_177078 | 3300042643 | Bacteria | 55313 |
| 15 | Ga0466709_237921 | 3300042648 | Bacteria | 101442 |
| 16 | Ga0466715_068620 | 3300042616 | Bacteria | 3606 |
| 17 | Ga0466715_292914 | 3300042616 | Bacteria | 6181 |
| 18 | Ga0466729_107028 | 3300042621 | Bacteria | 5489 |
| 19 | Ga0123357_10007074 | 3300009784 | Bacteria | 13806 |
| 20 | Ga0466690_020965 | 3300042590 | Bacteria | 8868 |
| 21 | Ga0466690_408627 | 3300042590 | Bacteria | 146519 |
| 22 | Ga0466691_029420 | 3300042593 | Bacteria | 25628 |
| 23 | IMNBL1DRAFT_c0000548 | 3300000062 | Bacteria | 30522 |
| 24 | Ga0068305_10134447 | 3300005083 | Bacteria | 3125 |
| 25 | Ga0104048_1170901 | 3300007143 | Unclassified | 1587 |
| 26 | Ga0104019_1003221 | 3300007150 | Unclassified | 2068 |
| 27 | Ga0466700_492515 | 3300042600 | Bacteria | 13946 |
| 28 | Ga0466707_381652 | 3300042601 | Bacteria | 5817 |
| 29 | Ga0466713_050542 | 3300042602 | Bacteria | 10326 |
| 30 | Ga0466713_117834 | 3300042602 | Bacteria | 19690 |
| 31 | Ga0466719_140159 | 3300042606 | Bacteria | 5277 |
| 32 | Ga0466704_125854 | 3300042643 | Bacteria | 6217 |
| 33 | Ga0466727_154754 | 3300042655 | Bacteria | 4616 |
| 34 | Ga0466711_221744 | 3300042615 | Bacteria | 19331 |
| 35 | Ga0466715_224032 | 3300042616 | Bacteria | 7386 |
| 36 | Ga0123357_10023964 | 3300009784 | Bacteria | 8208 |
| 37 | Ga0123355_10002877 | 3300009826 | Bacteria | 24450 |
| 38 | Ga0466657_098204 | 3300042582 | Bacteria | 4940 |
| 39 | Ga0466692_172080 | 3300042591 | Bacteria | 48787 |
| 40 | Ga0466701_045871 | 3300042598 | Bacteria | 16633 |
| 41 | Ga0466700_064016 | 3300042600 | Bacteria | 16340 |
| 42 | Ga0466700_337243 | 3300042600 | Bacteria | 9235 |
| 43 | Ga0466707_023238 | 3300042601 | Bacteria | 1438 |
| 44 | Ga0466707_124992 | 3300042601 | Bacteria | 11855 |
| 45 | Ga0466716_092980 | 3300042605 | Bacteria | 25359 |
| 46 | Ga0466708_128147 | 3300042652 | Bacteria | 3445 |
| 47 | Ga0466727_291286 | 3300042655 | Bacteria | 4125 |
| 48 | Ga0466715_634286 | 3300042616 | Unclassified | 3739 |
| 49 | Ga0466729_062898 | 3300042621 | Bacteria | 3193 |
| 50 | Ga0123357_10045775 | 3300009784 | Bacteria | 5934 |
| 51 | Ga0123354_10021129 | 3300010882 | Bacteria | 10254 |
| 52 | Ga0123354_10417590 | 3300010882 | Bacteria | 1118 |
| 53 | Ga0466656_062690 | 3300042550 | Bacteria | 1783 |
| 54 | Ga0466691_018426 | 3300042593 | Bacteria | 12730 |
| 55 | Ga0466691_119491 | 3300042593 | Bacteria | 14959 |
| 56 | 2227527130 | 2225789004 | Bacteria | 3222 |
| 57 | IMNBL1DRAFT_c0037389 | 3300000062 | Bacteria | 1683 |
| 58 | Ga0466707_198091 | 3300042601 | Bacteria | 10860 |
| 59 | Ga0466722_232113 | 3300042609 | Bacteria | 21009 |
| 60 | Ga0466735_097752 | 3300042624 | Bacteria | 6740 |
| 61 | Ga0466735_181457 | 3300042624 | Bacteria | 4317 |
| 62 | Ga0466727_090088 | 3300042655 | Bacteria | 55654 |
| 63 | Ga0466723_065515 | 3300042618 | Bacteria | 2245 |
| 64 | Ga0123353_10000436 | 3300010167 | Bacteria | 51718 |
| 65 | Ga0466696_446043 | 3300042596 | Bacteria | 1940 |
| 66 | JGI24702J35022_10112419 | 3300002462 | Bacteria | 1498 |
| 67 | Ga0466701_068703 | 3300042598 | Bacteria | 4398 |
| 68 | Ga0466707_218234 | 3300042601 | Bacteria | 13908 |
| 69 | Ga0466707_241018 | 3300042601 | Bacteria | 15636 |
| 70 | Ga0466707_400217 | 3300042601 | Bacteria | 9689 |
| 71 | Ga0466713_140387 | 3300042602 | Bacteria | 4580 |
| 72 | Ga0466719_497604 | 3300042606 | Bacteria | 6195 |
| 73 | Ga0466735_118349 | 3300042624 | Bacteria | 3834 |
| 74 | Ga0466704_082791 | 3300042643 | Bacteria | 24873 |
| 75 | Ga0466704_207718 | 3300042643 | Bacteria | 15398 |
| 76 | Ga0466708_032749 | 3300042652 | Bacteria | 1754 |
| 77 | Ga0466726_349824 | 3300042619 | Bacteria | 1881 |
| 78 | Ga0466705_185775 | 3300042612 | Bacteria | 5841 |
| 79 | Ga0466733_062739 | 3300042659 | Bacteria | 7082 |
| 80 | Ga0123357_10403305 | 3300009784 | Bacteria | 1241 |
| 81 | Ga0123355_10199284 | 3300009826 | Bacteria | 2929 |
| 82 | JGI24702J35022_10000837 | 3300002462 | Bacteria | 19047 |
| 83 | Ga0466701_032440 | 3300042598 | Bacteria | 36525 |
| 84 | Ga0466716_069257 | 3300042605 | Bacteria | 11853 |
| 85 | Ga0466735_140352 | 3300042624 | Bacteria | 1659 |
| 86 | Ga0466703_147859 | 3300042636 | Bacteria | 1949 |
| 87 | Ga0466711_018475 | 3300042615 | Bacteria | 8884 |
| 88 | Ga0466715_355335 | 3300042616 | Bacteria | 7535 |
| 89 | Ga0466723_160240 | 3300042618 | Bacteria | 6713 |
| 90 | Ga0466705_322543 | 3300042612 | Bacteria | 10172 |
| 91 | Ga0123354_10003291 | 3300010882 | Bacteria | 22202 |
| 92 | Ga0264413_132893 | 3300024493 | Bacteria | 3140 |
| 93 | Ga0466692_001103 | 3300042591 | Bacteria | 29670 |
| 94 | Ga0466695_006285 | 3300042595 | Bacteria | 21872 |
| 95 | JGI24696J40584_12946450 | 3300002834 | Bacteria | 1899 |
| 96 | Ga0466707_154277 | 3300042601 | Bacteria | 12010 |
| 97 | Ga0466707_383222 | 3300042601 | Bacteria | 43346 |
| 98 | Ga0466735_037453 | 3300042624 | Bacteria | 5588 |
| 99 | Ga0466709_167094 | 3300042648 | Bacteria | 7391 |
| 100 | Ga0466711_311194 | 3300042615 | Bacteria | 1591 |
| 101 | Ga0466705_139715 | 3300042612 | Bacteria | 34751 |
| 102 | Ga0123354_10104517 | 3300010882 | Bacteria | 3798 |
| 103 | Ga0466690_107750 | 3300042590 | Bacteria | 4954 |
| 104 | JGI24699J35502_11134231 | 3300002509 | Bacteria | 105586 |
| 105 | Ga0466707_209595 | 3300042601 | Bacteria | 1099 |
| 106 | Ga0466713_026532 | 3300042602 | Bacteria | 20893 |
| 107 | Ga0466713_034178 | 3300042602 | Bacteria | 2913 |
| 108 | Ga0466719_243135 | 3300042606 | Bacteria | 3434 |
| 109 | Ga0466735_071698 | 3300042624 | Bacteria | 4273 |
| 110 | Ga0466735_093207 | 3300042624 | Bacteria | 5401 |
| 111 | Ga0466703_104529 | 3300042636 | Bacteria | 3023 |
| 112 | Ga0466703_158861 | 3300042636 | Bacteria | 4617 |
| 113 | Ga0466709_277111 | 3300042648 | Bacteria | 42015 |
| 114 | Ga0466724_58610 | 3300042649 | Bacteria | 376410 |
| 115 | Ga0466705_433440 | 3300042612 | Bacteria | 3369 |
| 116 | Ga0466711_260000 | 3300042615 | Bacteria | 10405 |
| 117 | Ga0466715_052718 | 3300042616 | Bacteria | 1610 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00809 | Pterin_bind | Pterin binding enzyme | 24 | 263 | 0.99 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00809 | GO:0042558 | pteridine-containing compound metabolic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.