Protein Family IF05048
Metagenome
Isolate
194
Members
45
Samples
173
Scaffolds
173.24
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_355697|Ga0466694_355697_65_655
- Length
- 196 aa
- Sequence
- MPTIQKPQKRKNTMENKLLAPLSSLQWVDRNLLKPNNYNPNKVSRENLELLTQSIFSNGWTLPIVCRLDYTIIDGFHRWLVSGPDWTYKPVGKKQTLFELLGGKVPRVIVKHTDKSGDIYGTVTHNRARGTHLLEPMKNIVKLLLSQGKTTKEIGKELGMKPEEVFRLSDLSKEQFLAMMASRSDGYSKELYMRNM
Sample Types
Isolate
0.5%
Metagenome
99.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.2%
Kalotermitidae
30.2%
Unclassified
9.3%
Rhinotermitidae
7.0%
Termopsidae
4.7%
Hodotermitidae
2.3%
Passalidae
2.3%
Taxonomy
Archaea
4
Bacteria
119
Eukaryota
1
Viruses
1
Unclassified
69
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 35 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 39 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_135941 | 3300042612 | Bacteria | 1264 |
| 2 | Ga0466714_041938 | 3300042603 | Bacteria | 1376 |
| 3 | Ga0466720_115291 | 3300042607 | Unclassified | 1028 |
| 4 | Ga0466720_182316 | 3300042607 | Bacteria | 3007 |
| 5 | Ga0466722_187577 | 3300042609 | Bacteria | 7467 |
| 6 | Ga0123355_10139673 | 3300009826 | Bacteria | 3711 |
| 7 | Ga0123355_10153552 | 3300009826 | Bacteria | 3489 |
| 8 | Ga0123353_10168300 | 3300010167 | Bacteria | 3481 |
| 9 | Ga0466712_140526 | 3300042614 | Unclassified | 1261 |
| 10 | Ga0466711_272569 | 3300042615 | Bacteria | 11354 |
| 11 | Ga0466715_026735 | 3300042616 | Unclassified | 2221 |
| 12 | Ga0466723_292393 | 3300042618 | Unclassified | 1036 |
| 13 | Ga0466726_405825 | 3300042619 | Unclassified | 2008 |
| 14 | Ga0466729_234786 | 3300042621 | Unclassified | 7453 |
| 15 | Ga0466731_281777 | 3300042622 | Unclassified | 5571 |
| 16 | Ga0466704_049956 | 3300042643 | Bacteria | 12624 |
| 17 | Ga0466708_094257 | 3300042652 | Bacteria | 3386 |
| 18 | Ga0466708_271728 | 3300042652 | Bacteria | 1908 |
| 19 | JGI24698J34947_10038726 | 3300002449 | Bacteria | 2472 |
| 20 | Ga0264413_155131 | 3300024493 | Bacteria | 3977 |
| 21 | Ga0415639_113892 | 3300038395 | Unclassified | 1510 |
| 22 | Ga0466690_251631 | 3300042590 | Unclassified | 2250 |
| 23 | Ga0466692_044141 | 3300042591 | Unclassified | 2310 |
| 24 | Ga0466692_108571 | 3300042591 | Unclassified | 1329 |
| 25 | Ga0466692_185776 | 3300042591 | Bacteria | 2144 |
| 26 | Ga0466694_200244 | 3300042594 | Bacteria | 11437 |
| 27 | Ga0466696_035761 | 3300042596 | Unclassified | 1671 |
| 28 | Ga0466732_188899 | 3300042656 | Bacteria | 12995 |
| 29 | Ga0466732_356297 | 3300042656 | Bacteria | 3643 |
| 30 | Ga0466706_222864 | 3300042599 | Bacteria | 2490 |
| 31 | Ga0466719_190219 | 3300042606 | Unclassified | 2247 |
| 32 | Ga0466722_107956 | 3300042609 | Bacteria | 14240 |
| 33 | Ga0466722_164833 | 3300042609 | Bacteria | 4378 |
| 34 | Ga0123353_10000505 | 3300010167 | Bacteria | 48487 |
| 35 | Ga0466705_469753 | 3300042612 | Bacteria | 13248 |
| 36 | Ga0466711_020224 | 3300042615 | Bacteria | 41674 |
| 37 | Ga0466711_453764 | 3300042615 | Unclassified | 2418 |
| 38 | Ga0466718_167931 | 3300042617 | Bacteria | 27313 |
| 39 | Ga0466703_107351 | 3300042636 | Unclassified | 6611 |
| 40 | Ga0466709_302829 | 3300042648 | Unclassified | 1476 |
| 41 | Ga0466709_309845 | 3300042648 | Unclassified | 7229 |
| 42 | Ga0466727_212935 | 3300042655 | Bacteria | 1992 |
| 43 | JGI24695J34938_10015281 | 3300002450 | Bacteria | 3943 |
| 44 | Ga0072941_1300087 | 3300005201 | Bacteria | 979 |
| 45 | Ga0415639_158092 | 3300038395 | Unclassified | 1586 |
| 46 | Ga0415639_219734 | 3300038395 | Bacteria | 3970 |
| 47 | Ga0466694_355697 | 3300042594 | Bacteria | 1248 |
| 48 | Ga0466733_149940 | 3300042659 | Bacteria | 2418 |
| 49 | Ga0466716_297963 | 3300042605 | Bacteria | 4336 |
| 50 | Ga0466716_371444 | 3300042605 | Bacteria | 1368 |
| 51 | Ga0466719_337324 | 3300042606 | Bacteria | 2437 |
| 52 | Ga0466722_123869 | 3300042609 | Unclassified | 1340 |
| 53 | Ga0123356_10012908 | 3300010049 | Bacteria | 8088 |
| 54 | Ga0123356_10069316 | 3300010049 | Bacteria | 3307 |
| 55 | Ga0466712_301669 | 3300042614 | Bacteria | 91171 |
| 56 | Ga0466718_078294 | 3300042617 | Unclassified | 1075 |
| 57 | Ga0466726_173732 | 3300042619 | Bacteria | 2989 |
| 58 | Ga0466729_182431 | 3300042621 | Unclassified | 1089 |
| 59 | IMNBL1DRAFT_c0001782 | 3300000062 | Bacteria | 15764 |
| 60 | JGI24698J34947_10003832 | 3300002449 | Unclassified | 8187 |
| 61 | JGI24698J34947_10116321 | 3300002449 | Unclassified | 1170 |
| 62 | JGI24695J34938_10028426 | 3300002450 | Bacteria | 2628 |
| 63 | Ga0415639_091330 | 3300038395 | Bacteria | 3645 |
| 64 | Ga0466692_181258 | 3300042591 | Unclassified | 35635 |
| 65 | Ga0466691_097703 | 3300042593 | Unclassified | 5323 |
| 66 | Ga0466694_039696 | 3300042594 | Unclassified | 1579 |
| 67 | Ga0466705_279350 | 3300042612 | Archaea | 4958 |
| 68 | Ga0466733_030081 | 3300042659 | Unclassified | 1535 |
| 69 | Ga0466706_200867 | 3300042599 | Bacteria | 34337 |
| 70 | Ga0466706_206380 | 3300042599 | Bacteria | 1585 |
| 71 | Ga0466707_020445 | 3300042601 | Bacteria | 2042 |
| 72 | Ga0466721_022525 | 3300042608 | Unclassified | 1003 |
| 73 | Ga0123356_10029935 | 3300010049 | Bacteria | 5096 |
| 74 | Ga0123353_10200250 | 3300010167 | Bacteria | 3142 |
| 75 | Ga0123353_10424106 | 3300010167 | Bacteria | 1970 |
| 76 | Ga0466712_287884 | 3300042614 | Bacteria | 5674 |
| 77 | Ga0466709_305420 | 3300042648 | Bacteria | 4148 |
| 78 | JGI24695J34938_10031290 | 3300002450 | Bacteria | 2471 |
| 79 | JGI24702J35022_10112991 | 3300002462 | Bacteria | 1494 |
| 80 | Ga0415639_151981 | 3300038395 | Bacteria | 1967 |
| 81 | Ga0466692_004242 | 3300042591 | Bacteria | 17396 |
| 82 | Ga0466692_054173 | 3300042591 | Bacteria | 1710 |
| 83 | Ga0466694_300088 | 3300042594 | Bacteria | 1100 |
| 84 | Ga0466699_288395 | 3300042597 | Bacteria | 3487 |
| 85 | Ga0466707_069129 | 3300042601 | Bacteria | 51796 |
| 86 | Ga0466719_191520 | 3300042606 | Unclassified | 2132 |
| 87 | Ga0123357_10207116 | 3300009784 | Bacteria | 2215 |
| 88 | Ga0123355_10149908 | 3300009826 | Bacteria | 3546 |
| 89 | Ga0123356_10011352 | 3300010049 | Viruses | 8689 |
| 90 | Ga0123356_10023188 | 3300010049 | Bacteria | 5846 |
| 91 | Ga0123353_10007403 | 3300010167 | Bacteria | 14822 |
| 92 | Ga0123353_10274497 | 3300010167 | Bacteria | 2594 |
| 93 | Ga0123353_10609516 | 3300010167 | Unclassified | 1558 |
| 94 | Ga0466711_214691 | 3300042615 | Unclassified | 1835 |
| 95 | Ga0466718_099405 | 3300042617 | Unclassified | 1619 |
| 96 | Ga0466726_405309 | 3300042619 | Bacteria | 1983 |
| 97 | Ga0466704_461922 | 3300042643 | Bacteria | 22567 |
| 98 | Ga0466709_275895 | 3300042648 | Unclassified | 1468 |
| 99 | Ga0466708_415564 | 3300042652 | Unclassified | 1417 |
| 100 | IMNBL1DRAFT_c0003212 | 3300000062 | Bacteria | 10687 |
| 101 | JGI24698J34947_10000001 | 3300002449 | Bacteria | 71050 |
| 102 | Ga0415639_073586 | 3300038395 | Unclassified | 1590 |
| 103 | Ga0466692_053968 | 3300042591 | Bacteria | 6789 |
| 104 | Ga0466692_065632 | 3300042591 | Bacteria | 9947 |
| 105 | Ga0466705_190676 | 3300042612 | Archaea | 1979 |
| 106 | Ga0466705_217172 | 3300042612 | Bacteria | 2396 |
| 107 | Ga0466706_034243 | 3300042599 | Bacteria | 62584 |
| 108 | Ga0466713_020693 | 3300042602 | Bacteria | 6107 |
| 109 | Ga0466722_038425 | 3300042609 | Bacteria | 5555 |
| 110 | Ga0466722_071530 | 3300042609 | Unclassified | 1422 |
| 111 | Ga0123357_10078074 | 3300009784 | Bacteria | 4364 |
| 112 | Ga0123355_10405257 | 3300009826 | Bacteria | 1755 |
| 113 | Ga0123355_11415567 | 3300009826 | Unclassified | 686 |
| 114 | Ga0123356_10471475 | 3300010049 | Unclassified | 1407 |
| 115 | Ga0466712_082707 | 3300042614 | Bacteria | 14740 |
| 116 | Ga0466711_383504 | 3300042615 | Unclassified | 5633 |
| 117 | Ga0466715_264837 | 3300042616 | Bacteria | 4298 |
| 118 | Ga0466718_140309 | 3300042617 | Unclassified | 9071 |
| 119 | Ga0466723_010555 | 3300042618 | Bacteria | 8290 |
| 120 | Ga0466703_176536 | 3300042636 | Bacteria | 10530 |
| 121 | Ga0466704_413063 | 3300042643 | Bacteria | 63892 |
| 122 | Ga0466704_593506 | 3300042643 | Bacteria | 6714 |
| 123 | Ga0466727_158678 | 3300042655 | Bacteria | 1877 |
| 124 | JGI24698J34947_10012170 | 3300002449 | Bacteria | 4722 |
| 125 | JGI24702J35022_10248364 | 3300002462 | Unclassified | 1034 |
| 126 | Ga0072940_1032052 | 3300005200 | Unclassified | 3443 |
| 127 | Ga0466690_323288 | 3300042590 | Bacteria | 5143 |
| 128 | Ga0466691_177486 | 3300042593 | Bacteria | 1355 |
| 129 | Ga0466696_158576 | 3300042596 | Bacteria | 4914 |
| 130 | Ga0466696_191595 | 3300042596 | Bacteria | 6905 |
| 131 | Ga0466714_146184 | 3300042603 | Bacteria | 6083 |
| 132 | Ga0466719_536211 | 3300042606 | Unclassified | 2349 |
| 133 | Ga0123355_10207864 | 3300009826 | Bacteria | 2844 |
| 134 | Ga0123356_10000462 | 3300010049 | Bacteria | 45544 |
| 135 | Ga0466712_014698 | 3300042614 | Unclassified | 1342 |
| 136 | Ga0466712_313955 | 3300042614 | Archaea | 2791 |
| 137 | Ga0466718_121378 | 3300042617 | Bacteria | 1657 |
| 138 | Ga0466723_077680 | 3300042618 | Bacteria | 2238 |
| 139 | Ga0466723_077755 | 3300042618 | Unclassified | 2640 |
| 140 | Ga0466726_337114 | 3300042619 | Bacteria | 12006 |
| 141 | Ga0466704_101444 | 3300042643 | Bacteria | 25190 |
| 142 | JGI24698J34947_10001040 | 3300002449 | Bacteria | 14303 |
| 143 | JGI24698J34947_10103577 | 3300002449 | Unclassified | 1273 |
| 144 | JGI24695J34938_10067643 | 3300002450 | Bacteria | 1502 |
| 145 | Ga0072940_1002544 | 3300005200 | Bacteria | 28879 |
| 146 | Ga0072941_1000467 | 3300005201 | Bacteria | 54990 |
| 147 | Ga0072941_1000525 | 3300005201 | Bacteria | 86208 |
| 148 | Ga0072941_1016425 | 3300005201 | Bacteria | 7390 |
| 149 | Ga0072941_1394179 | 3300005201 | Unclassified | 904 |
| 150 | Ga0415639_114287 | 3300038395 | Bacteria | 3770 |
| 151 | Ga0466691_089202 | 3300042593 | Bacteria | 41644 |
| 152 | Ga0466696_247146 | 3300042596 | Unclassified | 1033 |
| 153 | Ga0466705_113748 | 3300042612 | Bacteria | 8074 |
| 154 | Ga0466705_382539 | 3300042612 | Unclassified | 18585 |
| 155 | Ga0466720_079539 | 3300042607 | Bacteria | 71236 |
| 156 | Ga0123355_10234584 | 3300009826 | Bacteria | 2613 |
| 157 | Ga0123355_10347138 | 3300009826 | Bacteria | 1971 |
| 158 | Ga0123356_10005899 | 3300010049 | Bacteria | 12432 |
| 159 | Ga0466726_396093 | 3300042619 | Archaea | 1432 |
| 160 | Ga0466731_046103 | 3300042622 | Bacteria | 2237 |
| 161 | Ga0466731_240682 | 3300042622 | Bacteria | 5119 |
| 162 | Ga0466703_014548 | 3300042636 | Unclassified | 2159 |
| 163 | Ga0466709_068330 | 3300042648 | Unclassified | 1908 |
| 164 | JGI24698J34947_10001698 | 3300002449 | Bacteria | 11771 |
| 165 | JGI24695J34938_10000244 | 3300002450 | Bacteria | 52292 |
| 166 | JGI24695J34938_10034873 | 3300002450 | Bacteria | 2305 |
| 167 | Ga0068305_10605219 | 3300005083 | Bacteria | 6074 |
| 168 | Ga0072940_1037656 | 3300005200 | Bacteria | 2114 |
| 169 | Ga0072941_1280301 | 3300005201 | Bacteria | 3148 |
| 170 | Ga0264413_121919 | 3300024493 | Unclassified | 1288 |
| 171 | Ga0415639_011750 | 3300038395 | Bacteria | 63238 |
| 172 | Ga0415639_272386 | 3300038395 | Bacteria | 1935 |
| 173 | Ga0466692_122856 | 3300042591 | Unclassified | 2237 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02195 | ParBc | ParB/Sulfiredoxin domain | 27 | 79 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.