Protein Family IF05033
Metagenome
Isolate
135
Members
55
Samples
124
Scaffolds
237.47
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_276978|Ga0466694_276978_580_1425
- Length
- 281 aa
- Sequence
- VGVIAKAYGFCNHWSFVPSCLTTDMGTVRRGTKLHAFMLVALMSSSNQPFKYLDVISSLFAVILVVSNIASSAKIVDMGFSLFGVPMAFDGGTLLFPLAYVLGDVLTEVYGFRAARRVIWTGFAALILSSLALFVLKSLPPEASWEAQTGSIAYNAVLGGMSTGGIVLASLSAYLAGELSNSMLHSKLKVLMKGRLLWVRAVGSSLAGELLDSLIFISVASAAGVFPRELFWTLVLTNYFLKCAIEVLILPLTYAAVRFLKRKEGVDVYDTGEKYNPFAPL
Sample Types
Isolate
8.2%
Metagenome
91.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.5%
Kalotermitidae
25.0%
Unclassified
23.1%
Rhinotermitidae
7.7%
Termopsidae
3.8%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
126
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 2 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 3 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 4 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 5 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 6 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 7 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 8 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 12 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 13 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 14 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 15 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 16 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 17 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 18 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 19 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 20 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 21 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 22 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 23 | 2228664004 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA | Metagenome | Termitidae |
| 24 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 25 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 28 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 29 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 30 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 31 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 34 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 35 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 36 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 37 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 41 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 42 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 43 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 44 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 45 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 46 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 47 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 48 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 49 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 50 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 51 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 52 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 53 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 54 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 55 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_376981 | 3300042601 | Bacteria | 1125 |
| 2 | Ga0466716_433907 | 3300042605 | Bacteria | 4866 |
| 3 | Ga0466722_037611 | 3300042609 | Bacteria | 5784 |
| 4 | Ga0466722_043969 | 3300042609 | Bacteria | 1769 |
| 5 | Ga0466703_012358 | 3300042636 | Bacteria | 13593 |
| 6 | Ga0466727_067440 | 3300042655 | Bacteria | 2344 |
| 7 | Ga0466726_310841 | 3300042619 | Bacteria | 5196 |
| 8 | JGI24695J34938_10000250 | 3300002450 | Bacteria | 51894 |
| 9 | JGI24695J34938_10016082 | 3300002450 | Bacteria | 3819 |
| 10 | JGI24695J34938_10019436 | 3300002450 | Bacteria | 3368 |
| 11 | JGI24695J34938_10024737 | 3300002450 | Unclassified | 2880 |
| 12 | JGI24695J34938_10030967 | 3300002450 | Unclassified | 2487 |
| 13 | Ga0415639_014801 | 3300038395 | Bacteria | 2031 |
| 14 | Ga0466690_161507 | 3300042590 | Bacteria | 1881 |
| 15 | Ga0466690_206892 | 3300042590 | Unclassified | 1335 |
| 16 | Ga0466690_393773 | 3300042590 | Unclassified | 1361 |
| 17 | Ga0466694_276978 | 3300042594 | Bacteria | 1559 |
| 18 | Ga0123356_10004591 | 3300010049 | Bacteria | 14240 |
| 19 | Ga0123356_10005000 | 3300010049 | Unclassified | 13598 |
| 20 | Ga0123356_10582172 | 3300010049 | Bacteria | 1283 |
| 21 | Ga0123353_10301003 | 3300010167 | Bacteria | 2448 |
| 22 | Ga0466705_243330 | 3300042612 | Bacteria | 12481 |
| 23 | Ga0466720_044740 | 3300042607 | Bacteria | 14215 |
| 24 | Ga0466722_025769 | 3300042609 | Bacteria | 3155 |
| 25 | Ga0466715_078641 | 3300042616 | Bacteria | 15592 |
| 26 | JGI24698J34947_10090320 | 3300002449 | Bacteria | 1407 |
| 27 | Ga0074263_110082 | 3300005485 | Bacteria | 1519 |
| 28 | Ga0264413_135930 | 3300024493 | Bacteria | 1809 |
| 29 | Ga0466699_298436 | 3300042597 | Bacteria | 2492 |
| 30 | Ga0466703_006818 | 3300042636 | Bacteria | 1491 |
| 31 | Ga0466709_172547 | 3300042648 | Bacteria | 1943 |
| 32 | Ga0466715_040501 | 3300042616 | Bacteria | 4244 |
| 33 | Ga0466715_301499 | 3300042616 | Bacteria | 1673 |
| 34 | 2230969689 | 2228664004 | Bacteria | 4834 |
| 35 | Ga0466692_086455 | 3300042591 | Bacteria | 1870 |
| 36 | Ga0466696_368787 | 3300042596 | Bacteria | 1393 |
| 37 | Ga0466699_116802 | 3300042597 | Bacteria | 4900 |
| 38 | Ga0123356_10673990 | 3300010049 | Bacteria | 1202 |
| 39 | Ga0466706_276511 | 3300042599 | Bacteria | 1592 |
| 40 | Ga0466719_295254 | 3300042606 | Bacteria | 26745 |
| 41 | Ga0466720_163749 | 3300042607 | Bacteria | 1024 |
| 42 | Ga0466722_195570 | 3300042609 | Bacteria | 7551 |
| 43 | Ga0466731_116995 | 3300042622 | Bacteria | 44195 |
| 44 | Ga0466708_075900 | 3300042652 | Bacteria | 6109 |
| 45 | Ga0466715_266587 | 3300042616 | Bacteria | 13713 |
| 46 | Ga0466726_242945 | 3300042619 | Bacteria | 1599 |
| 47 | JGI24695J34938_10003809 | 3300002450 | Bacteria | 10254 |
| 48 | JGI24695J34938_10011164 | 3300002450 | Bacteria | 4858 |
| 49 | Ga0074263_110927 | 3300005485 | Unclassified | 2218 |
| 50 | Ga0264413_104924 | 3300024493 | Bacteria | 11606 |
| 51 | Ga0466690_403719 | 3300042590 | Bacteria | 5249 |
| 52 | Ga0466690_416951 | 3300042590 | Bacteria | 1322 |
| 53 | Ga0123356_10553731 | 3300010049 | Unclassified | 1311 |
| 54 | Ga0466705_118148 | 3300042612 | Bacteria | 5614 |
| 55 | Ga0466717_311521 | 3300042604 | Bacteria | 2031 |
| 56 | Ga0466720_010279 | 3300042607 | Bacteria | 6711 |
| 57 | Ga0466731_133204 | 3300042622 | Bacteria | 1144 |
| 58 | Ga0466709_068269 | 3300042648 | Bacteria | 4888 |
| 59 | Ga0466712_099697 | 3300042614 | Bacteria | 14968 |
| 60 | Ga0466711_486235 | 3300042615 | Bacteria | 1773 |
| 61 | Ga0466718_078277 | 3300042617 | Bacteria | 4272 |
| 62 | Ga0466726_418866 | 3300042619 | Bacteria | 6986 |
| 63 | FAAS_10005711 | 3300001880 | Bacteria | 1040 |
| 64 | JGI24698J34947_10131931 | 3300002449 | Bacteria | 1066 |
| 65 | JGI24695J34938_10015564 | 3300002450 | Bacteria | 3899 |
| 66 | JGI24695J34938_10036981 | 3300002450 | Bacteria | 2222 |
| 67 | Ga0072941_1009410 | 3300005201 | Bacteria | 3824 |
| 68 | Ga0072941_1044424 | 3300005201 | Bacteria | 1682 |
| 69 | Ga0456237_0009808 | 3300041968 | Bacteria | 1422 |
| 70 | Ga0466692_173522 | 3300042591 | Bacteria | 8127 |
| 71 | Ga0466699_092364 | 3300042597 | Unclassified | 1748 |
| 72 | Ga0123356_10017764 | 3300010049 | Bacteria | 6759 |
| 73 | Ga0123356_10121674 | 3300010049 | Bacteria | 2540 |
| 74 | Ga0123356_10355643 | 3300010049 | Bacteria | 1590 |
| 75 | Ga0123354_10105350 | 3300010882 | Bacteria | 3774 |
| 76 | Ga0466721_050693 | 3300042608 | Bacteria | 3466 |
| 77 | Ga0466722_058406 | 3300042609 | Bacteria | 1882 |
| 78 | Ga0466698_516018 | 3300042610 | Bacteria | 2057 |
| 79 | Ga0466727_310830 | 3300042655 | Bacteria | 9177 |
| 80 | Ga0466711_340104 | 3300042615 | Bacteria | 1436 |
| 81 | Ga0466718_015746 | 3300042617 | Bacteria | 12839 |
| 82 | Ga0466723_131066 | 3300042618 | Bacteria | 51139 |
| 83 | Ga0466726_420578 | 3300042619 | Bacteria | 1125 |
| 84 | Nasutiter_Contig12130 | 2030936001 | Bacteria | 3208 |
| 85 | JGI24695J34938_10026757 | 3300002450 | Bacteria | 2736 |
| 86 | Ga0072940_1095735 | 3300005200 | Bacteria | 6535 |
| 87 | Ga0264413_107591 | 3300024493 | Bacteria | 2714 |
| 88 | Ga0466691_018419 | 3300042593 | Bacteria | 8048 |
| 89 | Ga0466696_263896 | 3300042596 | Bacteria | 1634 |
| 90 | Ga0123353_10007253 | 3300010167 | Bacteria | 14944 |
| 91 | Ga0466706_049779 | 3300042599 | Bacteria | 2116 |
| 92 | Ga0466722_016559 | 3300042609 | Bacteria | 21144 |
| 93 | Ga0466729_239271 | 3300042621 | Bacteria | 1446 |
| 94 | Ga0466731_018700 | 3300042622 | Bacteria | 1880 |
| 95 | Ga0466731_302324 | 3300042622 | Bacteria | 1193 |
| 96 | Ga0466727_125793 | 3300042655 | Bacteria | 26855 |
| 97 | Ga0466715_114789 | 3300042616 | Bacteria | 8006 |
| 98 | Ga0466715_244744 | 3300042616 | Bacteria | 5254 |
| 99 | Ga0466723_105758 | 3300042618 | Bacteria | 2151 |
| 100 | Ga0466723_190116 | 3300042618 | Bacteria | 1363 |
| 101 | Ga0466726_466217 | 3300042619 | Bacteria | 19263 |
| 102 | JGI24695J34938_10013716 | 3300002450 | Bacteria | 4242 |
| 103 | Ga0466694_066665 | 3300042594 | Bacteria | 1527 |
| 104 | Ga0466699_415379 | 3300042597 | Bacteria | 3670 |
| 105 | Ga0123356_10066173 | 3300010049 | Bacteria | 3382 |
| 106 | Ga0123353_10313180 | 3300010167 | Bacteria | 2387 |
| 107 | Ga0123354_10029532 | 3300010882 | Bacteria | 8620 |
| 108 | Ga0466717_149180 | 3300042604 | Bacteria | 1196 |
| 109 | Ga0466719_418280 | 3300042606 | Bacteria | 7339 |
| 110 | Ga0466720_093169 | 3300042607 | Bacteria | 1882 |
| 111 | Ga0466720_214787 | 3300042607 | Bacteria | 1337 |
| 112 | Ga0466722_230990 | 3300042609 | Bacteria | 2455 |
| 113 | Ga0466704_047884 | 3300042643 | Bacteria | 3766 |
| 114 | Ga0466727_035607 | 3300042655 | Unclassified | 1439 |
| 115 | Ga0466723_029941 | 3300042618 | Bacteria | 3850 |
| 116 | JGI24695J34938_10003974 | 3300002450 | Bacteria | 9967 |
| 117 | JGI24695J34938_10035011 | 3300002450 | Bacteria | 2299 |
| 118 | JGI24695J34938_10087653 | 3300002450 | Bacteria | 1280 |
| 119 | JGI24699J35502_11133824 | 3300002509 | Bacteria | 16531 |
| 120 | Ga0072941_1242439 | 3300005201 | Bacteria | 1356 |
| 121 | Ga0264413_100740 | 3300024493 | Bacteria | 17904 |
| 122 | Ga0466691_009320 | 3300042593 | Bacteria | 41319 |
| 123 | Ga0123356_11494190 | 3300010049 | Bacteria | 833 |
| 124 | Ga0123353_10374932 | 3300010167 | Bacteria | 2131 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02592 | Vut_1 | Putative vitamin uptake transporter | 90 | 255 | 0.94 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02592 | GO:1990397 | queuosine salvage | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.