Protein Family IF05010
Metagenome
Metatranscriptome
Isolate
187
Members
58
Samples
173
Scaffolds
390.73
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_196685|Ga0466694_196685_1933_3300
- Length
- 455 aa
- Sequence
- MKKSADNVCYVSLFAPIAVYRSLRANETTLTSIIVRVAGFARKFVLSAPYPCHPPMKFEMEETMSKRDRLSGNEAVANAIRQIGPDVIAAFPITPSTEIPQFISSFKADGLLDSEFVAVESEHSAMAACIGATSAGVRSLTATSSAGMALMYELLYVAASDRLPIVVAAVNRALTGPINIQADHSDSMGARDSGWIQIYSENAQEAYDNMLMAYRIAEHPDVRLPVMICQDGFITSHSVENIVIEDDKLVKDFVGEYQPDKYLLNPSESLSIGPYSIFAYYMEFKRQQFESMRNALKVIKDVSEEYGKLTGRNYGMLEKYRMDDAELGLLLMSSAAGTGKAAVDGLREKGIKAGLVKLRSFRPFPDEEIADALKDLKALGIMDRSDIFSGCGGPLGAEVRGALYGRVEGLRNINYVYGLGGRDIQVADFVAIFDELGRLAAGEEVPRCRYQGVRE
Sample Types
Isolate
7.5%
Metagenome
92.0%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.8%
Unclassified
26.3%
Kalotermitidae
24.6%
Rhinotermitidae
5.3%
Termopsidae
3.5%
Hodotermitidae
1.8%
Passalidae
1.8%
Taxonomy
Archaea
7
Bacteria
171
Eukaryota
0
Viruses
1
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 2 | 2772190993 | Unclassified Euryarchaeota Lab288P4bin101 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 14 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 20 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 21 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 22 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 32 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 33 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 34 | 2820539610 | Unclassified Firmicutes Lab288P1bin136 | Isolate | Unclassified |
| 35 | 2820613375 | Unclassified Firmicutes Emb289P1bin134 | Isolate | Unclassified |
| 36 | 2820406809 | Unclassified Firmicutes Lab288P4bin87 | Isolate | Unclassified |
| 37 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 38 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 39 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 40 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 41 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 42 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 43 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 44 | 2820615445 | Unclassified Firmicutes Emb289P1bin132 | Isolate | Unclassified |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 2820617402 | Unclassified Firmicutes Emb289P1bin131 | Isolate | Unclassified |
| 51 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 52 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 53 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 54 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 55 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 56 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 57 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 58 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_285885 | 3300042612 | Bacteria | 1687 |
| 2 | Ga0123355_10281012 | 3300009826 | Unclassified | 2298 |
| 3 | Ga0123353_10311966 | 3300010167 | Bacteria | 2393 |
| 4 | Ga0466715_409955 | 3300042616 | Bacteria | 3452 |
| 5 | Ga0466723_112190 | 3300042618 | Bacteria | 3478 |
| 6 | Ga0466726_176348 | 3300042619 | Bacteria | 2677 |
| 7 | Ga0466726_196871 | 3300042619 | Bacteria | 1375 |
| 8 | Ga0466706_288143 | 3300042599 | Bacteria | 1726 |
| 9 | Ga0466707_136448 | 3300042601 | Bacteria | 7744 |
| 10 | Ga0466719_383538 | 3300042606 | Unclassified | 1327 |
| 11 | Ga0466722_257319 | 3300042609 | Bacteria | 3878 |
| 12 | IMNBL1DRAFT_c0000422 | 3300000062 | Bacteria | 35538 |
| 13 | Ga0466729_316237 | 3300042621 | Bacteria | 22092 |
| 14 | Ga0466703_302096 | 3300042636 | Unclassified | 2998 |
| 15 | Ga0466704_160092 | 3300042643 | Bacteria | 2295 |
| 16 | Ga0466709_261935 | 3300042648 | Bacteria | 22275 |
| 17 | Ga0466727_060522 | 3300042655 | Bacteria | 5157 |
| 18 | Ga0466694_174371 | 3300042594 | Bacteria | 3600 |
| 19 | Ga0466705_273889 | 3300042612 | Bacteria | 1946 |
| 20 | Ga0123355_10000163 | 3300009826 | Bacteria | 81520 |
| 21 | Ga0123355_10002139 | 3300009826 | Bacteria | 27898 |
| 22 | Ga0123355_10311506 | 3300009826 | Bacteria | 2133 |
| 23 | Ga0123355_10315696 | 3300009826 | Bacteria | 2112 |
| 24 | Ga0123356_10007504 | 3300010049 | Unclassified | 10875 |
| 25 | Ga0466706_179574 | 3300042599 | Bacteria | 7020 |
| 26 | Ga0466707_057550 | 3300042601 | Bacteria | 2313 |
| 27 | Ga0466716_002369 | 3300042605 | Bacteria | 11317 |
| 28 | JGI24695J34938_10046713 | 3300002450 | Bacteria | 1916 |
| 29 | Ga0466703_175253 | 3300042636 | Bacteria | 8925 |
| 30 | Ga0466690_071587 | 3300042590 | Bacteria | 5658 |
| 31 | Ga0466691_088322 | 3300042593 | Bacteria | 2510 |
| 32 | Ga0466696_220553 | 3300042596 | Bacteria | 5229 |
| 33 | Ga0466705_110916 | 3300042612 | Bacteria | 65673 |
| 34 | Ga0466705_282032 | 3300042612 | Bacteria | 2033 |
| 35 | Ga0466732_112578 | 3300042656 | Bacteria | 16046 |
| 36 | Ga0123355_10000169 | 3300009826 | Bacteria | 79359 |
| 37 | Ga0123355_10000712 | 3300009826 | Bacteria | 45162 |
| 38 | Ga0123355_10036309 | 3300009826 | Bacteria | 8012 |
| 39 | Ga0123355_10229563 | 3300009826 | Bacteria | 2653 |
| 40 | Ga0123355_10299621 | 3300009826 | Bacteria | 2194 |
| 41 | Ga0123356_10108442 | 3300010049 | Bacteria | 2677 |
| 42 | Ga0123353_10022023 | 3300010167 | Bacteria | 9589 |
| 43 | Ga0123353_10061004 | 3300010167 | Bacteria | 6047 |
| 44 | Ga0123353_10164659 | 3300010167 | Bacteria | 3526 |
| 45 | Ga0123353_10170373 | 3300010167 | Bacteria | 3457 |
| 46 | Ga0123353_10209427 | 3300010167 | Bacteria | 3059 |
| 47 | Ga0466726_013094 | 3300042619 | Bacteria | 1598 |
| 48 | Ga0466706_033081 | 3300042599 | Bacteria | 1828 |
| 49 | Ga0466700_067571 | 3300042600 | Bacteria | 2225 |
| 50 | Ga0466707_128362 | 3300042601 | Bacteria | 27013 |
| 51 | Ga0466707_141553 | 3300042601 | Bacteria | 8298 |
| 52 | Ga0466722_015515 | 3300042609 | Bacteria | 8002 |
| 53 | IMNBL1DRAFT_c0001007 | 3300000062 | Bacteria | 21724 |
| 54 | Ga0466703_065686 | 3300042636 | Bacteria | 26926 |
| 55 | Ga0466704_010688 | 3300042643 | Bacteria | 3414 |
| 56 | Ga0415639_000285 | 3300038395 | Bacteria | 3228 |
| 57 | Ga0466692_167471 | 3300042591 | Bacteria | 24626 |
| 58 | Ga0466694_017302 | 3300042594 | Bacteria | 1858 |
| 59 | Ga0466696_163379 | 3300042596 | Bacteria | 3549 |
| 60 | Ga0466732_196541 | 3300042656 | Bacteria | 122148 |
| 61 | Ga0123355_10000708 | 3300009826 | Bacteria | 45250 |
| 62 | Ga0123355_10021872 | 3300009826 | Bacteria | 10246 |
| 63 | Ga0123355_10039120 | 3300009826 | Bacteria | 7714 |
| 64 | Ga0123355_10061690 | 3300009826 | Bacteria | 6052 |
| 65 | Ga0123355_10090641 | 3300009826 | Bacteria | 4849 |
| 66 | Ga0123355_10125259 | 3300009826 | Bacteria | 3972 |
| 67 | Ga0123355_10483426 | 3300009826 | Bacteria | 1539 |
| 68 | Ga0123353_10025445 | 3300010167 | Bacteria | 9019 |
| 69 | Ga0466723_023324 | 3300042618 | Bacteria | 7109 |
| 70 | Ga0466723_196764 | 3300042618 | Bacteria | 4781 |
| 71 | Ga0466707_133081 | 3300042601 | Bacteria | 26278 |
| 72 | Ga0466707_276736 | 3300042601 | Bacteria | 11408 |
| 73 | Ga0466707_383777 | 3300042601 | Bacteria | 2758 |
| 74 | Ga0466713_059769 | 3300042602 | Bacteria | 172763 |
| 75 | Ga0466713_151171 | 3300042602 | Bacteria | 17884 |
| 76 | JGI24700J35501_10930335 | 3300002508 | Bacteria | 13112 |
| 77 | Ga0466734_145803 | 3300042623 | Bacteria | 2221 |
| 78 | Ga0466703_177121 | 3300042636 | Bacteria | 2639 |
| 79 | Ga0466727_297031 | 3300042655 | Bacteria | 16177 |
| 80 | Ga0233288_1009015 | 3300022232 | Bacteria | 2874 |
| 81 | Ga0466693_046107 | 3300042592 | Archaea | 2099 |
| 82 | Ga0466696_461950 | 3300042596 | Archaea | 3881 |
| 83 | Ga0123355_10000137 | 3300009826 | Bacteria | 86760 |
| 84 | Ga0123355_10000425 | 3300009826 | Bacteria | 55188 |
| 85 | Ga0123355_10000798 | 3300009826 | Bacteria | 43111 |
| 86 | Ga0123355_10001474 | 3300009826 | Bacteria | 32752 |
| 87 | Ga0123355_10173634 | 3300009826 | Bacteria | 3215 |
| 88 | Ga0123355_10246847 | 3300009826 | Bacteria | 2520 |
| 89 | Ga0123355_10267051 | 3300009826 | Bacteria | 2384 |
| 90 | Ga0123355_10314245 | 3300009826 | Viruses | 2119 |
| 91 | Ga0123354_10100825 | 3300010882 | Archaea | 3905 |
| 92 | Ga0466710_316081 | 3300042613 | Archaea | 3086 |
| 93 | Ga0466711_063294 | 3300042615 | Bacteria | 3340 |
| 94 | Ga0466711_245138 | 3300042615 | Unclassified | 5632 |
| 95 | Ga0466715_236347 | 3300042616 | Bacteria | 15758 |
| 96 | Ga0466726_108283 | 3300042619 | Bacteria | 13947 |
| 97 | Ga0466728_017755 | 3300042620 | Bacteria | 55878 |
| 98 | Ga0466706_108854 | 3300042599 | Bacteria | 3750 |
| 99 | Ga0466707_026018 | 3300042601 | Unclassified | 2446 |
| 100 | Ga0466707_079270 | 3300042601 | Bacteria | 9664 |
| 101 | Ga0466707_123662 | 3300042601 | Bacteria | 22376 |
| 102 | Ga0466707_302119 | 3300042601 | Archaea | 3202 |
| 103 | Ga0466707_344188 | 3300042601 | Bacteria | 1857 |
| 104 | Ga0466703_038750 | 3300042636 | Bacteria | 2712 |
| 105 | Ga0466703_289148 | 3300042636 | Bacteria | 257603 |
| 106 | Ga0466704_155886 | 3300042643 | Bacteria | 3738 |
| 107 | Ga0466696_113064 | 3300042596 | Bacteria | 15775 |
| 108 | Ga0466696_412818 | 3300042596 | Bacteria | 6145 |
| 109 | Ga0466705_163322 | 3300042612 | Bacteria | 155241 |
| 110 | Ga0123357_10083249 | 3300009784 | Bacteria | 4199 |
| 111 | Ga0123355_10000007 | 3300009826 | Bacteria | 193006 |
| 112 | Ga0123355_10247217 | 3300009826 | Bacteria | 2517 |
| 113 | Ga0123355_10288015 | 3300009826 | Bacteria | 2258 |
| 114 | Ga0123356_10011491 | 3300010049 | Bacteria | 8628 |
| 115 | Ga0123356_10083123 | 3300010049 | Bacteria | 3033 |
| 116 | Ga0466715_094489 | 3300042616 | Bacteria | 25727 |
| 117 | Ga0466718_075105 | 3300042617 | Bacteria | 2171 |
| 118 | Ga0466723_172322 | 3300042618 | Bacteria | 7972 |
| 119 | Ga0466728_121192 | 3300042620 | Bacteria | 7258 |
| 120 | Ga0466707_207148 | 3300042601 | Bacteria | 55703 |
| 121 | Ga0466707_289569 | 3300042601 | Bacteria | 7562 |
| 122 | Ga0466722_140838 | 3300042609 | Bacteria | 2372 |
| 123 | Ga0466734_077313 | 3300042623 | Archaea | 13094 |
| 124 | Ga0466704_217687 | 3300042643 | Bacteria | 53708 |
| 125 | Ga0466725_281694 | 3300042654 | Bacteria | 6492 |
| 126 | Ga0466692_121745 | 3300042591 | Bacteria | 37508 |
| 127 | Ga0466692_192911 | 3300042591 | Unclassified | 1515 |
| 128 | Ga0466694_014319 | 3300042594 | Bacteria | 5964 |
| 129 | Ga0466705_035944 | 3300042612 | Bacteria | 2275 |
| 130 | Ga0466705_070622 | 3300042612 | Bacteria | 7514 |
| 131 | Ga0123355_10000236 | 3300009826 | Bacteria | 70725 |
| 132 | Ga0123355_10009611 | 3300009826 | Bacteria | 14736 |
| 133 | Ga0123355_10114932 | 3300009826 | Bacteria | 4194 |
| 134 | Ga0123355_10319840 | 3300009826 | Bacteria | 2092 |
| 135 | Ga0123356_10039010 | 3300010049 | Bacteria | 4425 |
| 136 | Ga0123356_10104271 | 3300010049 | Bacteria | 2726 |
| 137 | Ga0123354_10015872 | 3300010882 | Bacteria | 11787 |
| 138 | Ga0466711_435615 | 3300042615 | Bacteria | 6976 |
| 139 | Ga0466726_072525 | 3300042619 | Bacteria | 10313 |
| 140 | Ga0466729_155428 | 3300042621 | Bacteria | 41381 |
| 141 | Ga0466714_065131 | 3300042603 | Bacteria | 171349 |
| 142 | Ga0466722_158555 | 3300042609 | Bacteria | 3949 |
| 143 | Ga0105524_105363 | 3300007733 | Bacteria | 2852 |
| 144 | Ga0466704_074060 | 3300042643 | Bacteria | 20452 |
| 145 | Ga0466692_096767 | 3300042591 | Bacteria | 2443 |
| 146 | Ga0466694_196685 | 3300042594 | Bacteria | 3474 |
| 147 | Ga0466705_110615 | 3300042612 | Bacteria | 9331 |
| 148 | Ga0466705_249606 | 3300042612 | Bacteria | 3495 |
| 149 | Ga0123355_10002608 | 3300009826 | Bacteria | 25579 |
| 150 | Ga0123355_10027676 | 3300009826 | Bacteria | 9158 |
| 151 | Ga0123355_10083182 | 3300009826 | Bacteria | 5103 |
| 152 | Ga0123355_10099222 | 3300009826 | Bacteria | 4590 |
| 153 | Ga0123356_10005529 | 3300010049 | Bacteria | 12857 |
| 154 | Ga0123353_10192335 | 3300010167 | Bacteria | 3219 |
| 155 | Ga0466726_374993 | 3300042619 | Bacteria | 9560 |
| 156 | Ga0466706_156785 | 3300042599 | Bacteria | 7397 |
| 157 | Ga0466707_329239 | 3300042601 | Bacteria | 2769 |
| 158 | Ga0466707_350983 | 3300042601 | Bacteria | 18008 |
| 159 | Ga0466713_089138 | 3300042602 | Bacteria | 1980 |
| 160 | Ga0466717_251192 | 3300042604 | Bacteria | 1551 |
| 161 | Ga0466719_067204 | 3300042606 | Bacteria | 6261 |
| 162 | Ga0466719_152038 | 3300042606 | Bacteria | 2921 |
| 163 | Ga0466703_191444 | 3300042636 | Bacteria | 3722 |
| 164 | Ga0466704_102161 | 3300042643 | Unclassified | 4835 |
| 165 | Ga0466704_223321 | 3300042643 | Bacteria | 20344 |
| 166 | Ga0466724_40609 | 3300042649 | Bacteria | 2009 |
| 167 | Ga0466708_000584 | 3300042652 | Bacteria | 5303 |
| 168 | Ga0466708_229616 | 3300042652 | Bacteria | 8864 |
| 169 | Ga0466708_270559 | 3300042652 | Bacteria | 3234 |
| 170 | Ga0466727_029142 | 3300042655 | Bacteria | 9896 |
| 171 | Ga0415639_019488 | 3300038395 | Bacteria | 2476 |
| 172 | Ga0466691_032116 | 3300042593 | Bacteria | 33249 |
| 173 | Ga0466696_036667 | 3300042596 | Bacteria | 22217 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01855 | GO:0016491 | oxidoreductase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.