Protein Family IF04951
Metagenome
Isolate
142
Members
45
Samples
136
Scaffolds
335.9
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_214743|Ga0466691_214743_6364_7518
- Length
- 365 aa
- Sequence
- MHRRYGTIAQPENNNYICTQIILTEIMKDNYCVIMGGGIGSRFWPFSRETRPKQFLDFFGTGRSLLQQTFDRFAQIVPSENIYIATNRKYADLVRQQLPDISDNQMLLEPTRRNTAPCIAYAAYRIRSINPNANMVVTPADHLILQEQNFLKNIQTGLNFAGKFPSLLTLGVKPNRPETGYGYIQTEEGGNDNIQKVKAFTEKPNYELATVFILNAFHTHLPDMTTRFDQGMGKFNTPAEAAFIEEQYPMCQNISIDYGIMEKDDNVYMLMADFGWSDLGTWGSLYDLAGKDDHLNATLKGKTLFIGSANNLVTLPDEKLAVIQGLDDYIIAESDDILLICKKSDEQRIKQFVADVNMRFGAKYL
Sample Types
Isolate
4.2%
Metagenome
95.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
32.6%
Termitidae
23.3%
Unclassified
16.3%
Rhinotermitidae
9.3%
Termopsidae
7.0%
Passalidae
4.7%
Aphididae
2.3%
Blattidae
2.3%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 5 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 6 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 7 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 8 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 9 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 10 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 13 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 14 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 15 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 29 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 37 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 38 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 39 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 42 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 43 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 44 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 45 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10319315 | 3300009784 | Bacteria | 1537 |
| 2 | Ga0123357_10379759 | 3300009784 | Bacteria | 1313 |
| 3 | IMNBL1DRAFT_c0005911 | 3300000062 | Bacteria | 6851 |
| 4 | JGI24705J35276_12215793 | 3300002504 | Bacteria | 2018 |
| 5 | JGI24699J35502_11134009 | 3300002509 | Bacteria | 23995 |
| 6 | JGI24696J40584_12959153 | 3300002834 | Bacteria | 4772 |
| 7 | Ga0068305_10010047 | 3300005083 | Bacteria | 10387 |
| 8 | Ga0068305_11091771 | 3300005083 | Bacteria | 3334 |
| 9 | Ga0466690_082262 | 3300042590 | Bacteria | 20112 |
| 10 | Ga0466690_177699 | 3300042590 | Bacteria | 12588 |
| 11 | Ga0466692_147419 | 3300042591 | Bacteria | 1296 |
| 12 | Ga0466691_103774 | 3300042593 | Bacteria | 2615 |
| 13 | Ga0466713_054215 | 3300042602 | Bacteria | 3064 |
| 14 | Ga0466722_035543 | 3300042609 | Bacteria | 116913 |
| 15 | Ga0466722_180072 | 3300042609 | Bacteria | 4500 |
| 16 | Ga0466729_210698 | 3300042621 | Bacteria | 20113 |
| 17 | Ga0466729_276166 | 3300042621 | Bacteria | 2270 |
| 18 | Ga0466735_107052 | 3300042624 | Bacteria | 2171 |
| 19 | Ga0466704_605169 | 3300042643 | Bacteria | 3954 |
| 20 | Ga0466709_172128 | 3300042648 | Bacteria | 26267 |
| 21 | Ga0466708_230723 | 3300042652 | Bacteria | 10645 |
| 22 | Ga0123356_10328628 | 3300010049 | Bacteria | 1645 |
| 23 | Ga0127649_100123 | 3300009460 | Bacteria | 51721 |
| 24 | Ga0466710_345832 | 3300042613 | Bacteria | 1465 |
| 25 | Ga0466711_090299 | 3300042615 | Bacteria | 47995 |
| 26 | Ga0466715_586319 | 3300042616 | Bacteria | 4408 |
| 27 | Ga0466726_290438 | 3300042619 | Bacteria | 8355 |
| 28 | Ga0466696_067335 | 3300042596 | Bacteria | 7101 |
| 29 | Ga0466700_021305 | 3300042600 | Bacteria | 30578 |
| 30 | Ga0466700_257713 | 3300042600 | Bacteria | 15144 |
| 31 | Ga0466707_033660 | 3300042601 | Bacteria | 25263 |
| 32 | Ga0466703_248560 | 3300042636 | Bacteria | 44932 |
| 33 | Ga0123354_10011453 | 3300010882 | Bacteria | 13707 |
| 34 | Ga0123354_10132251 | 3300010882 | Bacteria | 3143 |
| 35 | Ga0466711_471579 | 3300042615 | Bacteria | 1209 |
| 36 | Ga0466723_138332 | 3300042618 | Bacteria | 7457 |
| 37 | Ga0466696_234160 | 3300042596 | Bacteria | 1583 |
| 38 | Ga0466701_098566 | 3300042598 | Bacteria | 20155 |
| 39 | Ga0466706_224910 | 3300042599 | Bacteria | 52692 |
| 40 | Ga0466707_416912 | 3300042601 | Bacteria | 2136 |
| 41 | Ga0466713_068672 | 3300042602 | Bacteria | 133468 |
| 42 | Ga0466713_077959 | 3300042602 | Bacteria | 15097 |
| 43 | Ga0466713_153612 | 3300042602 | Bacteria | 4823 |
| 44 | Ga0466719_356439 | 3300042606 | Bacteria | 2584 |
| 45 | Ga0466735_020932 | 3300042624 | Bacteria | 1772 |
| 46 | Ga0466703_318218 | 3300042636 | Bacteria | 1342 |
| 47 | Ga0466727_151884 | 3300042655 | Bacteria | 54336 |
| 48 | Ga0123357_10027121 | 3300009784 | Unclassified | 7739 |
| 49 | Ga0123354_10006316 | 3300010882 | Bacteria | 17574 |
| 50 | Ga0123354_10161851 | 3300010882 | Bacteria | 2652 |
| 51 | IMNBL1DRAFT_c0003894 | 3300000062 | Bacteria | 9263 |
| 52 | Ga0068305_10047177 | 3300005083 | Bacteria | 7475 |
| 53 | Ga0466711_147763 | 3300042615 | Bacteria | 12121 |
| 54 | Ga0466726_040298 | 3300042619 | Bacteria | 11019 |
| 55 | Ga0466726_252612 | 3300042619 | Bacteria | 3342 |
| 56 | Ga0466728_061783 | 3300042620 | Bacteria | 5508 |
| 57 | Ga0466692_030541 | 3300042591 | Bacteria | 59720 |
| 58 | Ga0466691_214743 | 3300042593 | Bacteria | 11007 |
| 59 | Ga0466696_088985 | 3300042596 | Bacteria | 12095 |
| 60 | Ga0466707_054387 | 3300042601 | Bacteria | 59888 |
| 61 | Ga0466707_286082 | 3300042601 | Bacteria | 3397 |
| 62 | Ga0466707_287996 | 3300042601 | Bacteria | 10549 |
| 63 | Ga0466705_072196 | 3300042612 | Bacteria | 3435 |
| 64 | Ga0466735_038091 | 3300042624 | Bacteria | 4511 |
| 65 | Ga0466703_364164 | 3300042636 | Bacteria | 2677 |
| 66 | Ga0466704_135353 | 3300042643 | Bacteria | 1736 |
| 67 | Ga0466709_165812 | 3300042648 | Bacteria | 4283 |
| 68 | Ga0123354_10000260 | 3300010882 | Bacteria | 47442 |
| 69 | Ga0123354_10009913 | 3300010882 | Bacteria | 14642 |
| 70 | Ga0123354_10020243 | 3300010882 | Bacteria | 10459 |
| 71 | 2227632958 | 2225789004 | Bacteria | 11294 |
| 72 | JGI24702J35022_10039936 | 3300002462 | Unclassified | 2503 |
| 73 | Ga0466711_505356 | 3300042615 | Bacteria | 1348 |
| 74 | Ga0466715_000756 | 3300042616 | Bacteria | 5724 |
| 75 | Ga0466715_031489 | 3300042616 | Bacteria | 6628 |
| 76 | Ga0466715_474042 | 3300042616 | Bacteria | 5704 |
| 77 | Ga0466726_481576 | 3300042619 | Bacteria | 1585 |
| 78 | Ga0466690_394866 | 3300042590 | Bacteria | 116329 |
| 79 | Ga0466692_149013 | 3300042591 | Bacteria | 10943 |
| 80 | Ga0466692_190201 | 3300042591 | Bacteria | 2034 |
| 81 | Ga0466700_346378 | 3300042600 | Bacteria | 1787 |
| 82 | Ga0466707_119043 | 3300042601 | Bacteria | 2252 |
| 83 | Ga0466735_072950 | 3300042624 | Bacteria | 3165 |
| 84 | Ga0466735_076874 | 3300042624 | Bacteria | 3083 |
| 85 | Ga0466735_094109 | 3300042624 | Unclassified | 1963 |
| 86 | Ga0466735_107743 | 3300042624 | Bacteria | 2243 |
| 87 | Ga0466735_116092 | 3300042624 | Bacteria | 5858 |
| 88 | Ga0466703_223669 | 3300042636 | Bacteria | 3492 |
| 89 | Ga0466704_106682 | 3300042643 | Bacteria | 6932 |
| 90 | Ga0466704_157477 | 3300042643 | Bacteria | 12306 |
| 91 | Ga0466704_307178 | 3300042643 | Bacteria | 2486 |
| 92 | Ga0123354_10019892 | 3300010882 | Bacteria | 10547 |
| 93 | Ga0072941_1087397 | 3300005201 | Bacteria | 5497 |
| 94 | Ga0123357_10000629 | 3300009784 | Bacteria | 34969 |
| 95 | Ga0466723_304195 | 3300042618 | Bacteria | 13048 |
| 96 | Ga0456237_0000002 | 3300041968 | Bacteria | 104267 |
| 97 | Ga0466700_064111 | 3300042600 | Bacteria | 1471 |
| 98 | Ga0466707_003680 | 3300042601 | Bacteria | 29693 |
| 99 | Ga0466707_328470 | 3300042601 | Bacteria | 9694 |
| 100 | Ga0466713_100156 | 3300042602 | Bacteria | 17601 |
| 101 | Ga0466719_021458 | 3300042606 | Bacteria | 7244 |
| 102 | Ga0466735_136195 | 3300042624 | Bacteria | 4189 |
| 103 | Ga0466703_170534 | 3300042636 | Bacteria | 16042 |
| 104 | Ga0123357_10018086 | 3300009784 | Unclassified | 9362 |
| 105 | Ga0123357_10068138 | 3300009784 | Bacteria | 4737 |
| 106 | Ga0123354_10255307 | 3300010882 | Bacteria | 1765 |
| 107 | 2227266903 | 2225789004 | Bacteria | 6952 |
| 108 | JGI24699J35502_11134035 | 3300002509 | Bacteria | 25887 |
| 109 | Ga0123357_10000491 | 3300009784 | Bacteria | 38307 |
| 110 | Ga0466705_440502 | 3300042612 | Unclassified | 7032 |
| 111 | Ga0466726_301924 | 3300042619 | Bacteria | 5230 |
| 112 | Ga0466729_041176 | 3300042621 | Bacteria | 7040 |
| 113 | Ga0466701_032214 | 3300042598 | Bacteria | 43207 |
| 114 | Ga0466706_289041 | 3300042599 | Bacteria | 4711 |
| 115 | Ga0466713_116549 | 3300042602 | Bacteria | 10689 |
| 116 | Ga0466722_205158 | 3300042609 | Bacteria | 23241 |
| 117 | Ga0466705_267581 | 3300042612 | Bacteria | 2036 |
| 118 | Ga0466703_356236 | 3300042636 | Bacteria | 12720 |
| 119 | Ga0123356_10023521 | 3300010049 | Bacteria | 5797 |
| 120 | JGI24699J35502_11134030 | 3300002509 | Bacteria | 25274 |
| 121 | Ga0466715_101945 | 3300042616 | Bacteria | 16309 |
| 122 | Ga0466715_361265 | 3300042616 | Bacteria | 6401 |
| 123 | Ga0466723_108577 | 3300042618 | Bacteria | 9165 |
| 124 | Ga0466728_340299 | 3300042620 | Bacteria | 1886 |
| 125 | Ga0466692_008187 | 3300042591 | Bacteria | 121981 |
| 126 | Ga0466707_067503 | 3300042601 | Unclassified | 8949 |
| 127 | Ga0466707_077733 | 3300042601 | Bacteria | 3528 |
| 128 | Ga0466716_038510 | 3300042605 | Bacteria | 24976 |
| 129 | Ga0466716_412055 | 3300042605 | Bacteria | 5781 |
| 130 | Ga0466719_050060 | 3300042606 | Bacteria | 5266 |
| 131 | Ga0466722_049476 | 3300042609 | Bacteria | 19365 |
| 132 | Ga0466705_132356 | 3300042612 | Bacteria | 7577 |
| 133 | Ga0466735_232712 | 3300042624 | Bacteria | 2118 |
| 134 | Ga0466703_098405 | 3300042636 | Bacteria | 4437 |
| 135 | Ga0466704_422577 | 3300042643 | Bacteria | 21146 |
| 136 | Ga0466727_291871 | 3300042655 | Bacteria | 3712 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00483 | GO:0009058 | biosynthetic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.