Protein Family IF04874

Metagenome Isolate
189 Members
74 Samples
156 Scaffolds
418.92 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_072180|Ga0466691_072180_1486_3021
Length
511 aa
Sequence
MATFAPLATLSPASWPAKGLAFWPEWTVLALWLNYWFLFLAIDCRLSYNHNATGKAANVPAGAVGREIGARRPWEDNPSTEGWAHKIKRSHETVNHDIKDINLASKGNDRIEWAAKSMPVLELIGERFKKEQPLKGLRLGLCLHVTTETASLCRVLKAGGGEVYLCASNPLSTQDEVAAALVKFDGIPVFAVKGEDNPTYYKHIHSVLDAKPHMTMDDGADLLSTLHAEKPELLAGVIGGTEETTTGIIRLRAMAAEKALKYPVVAVNDAMTKHFFDNRYGTGQSTIDGIVRSTNRLLAGSVFVISGYGWCGRGVAKRASGMGARVVVTEVDPLKALEAIMDGFNVMTLAQAAKIGDFFVTVTGDVNVIRPEHFKLMKSGAIVCNSGHFNVELDLEGLAKVTEKRREVRDFVEEYVIKDGPTVYLLGEGRLINLAAAEGHPSSVMDMSFANQALSAEYVKRHQGKLPLEVFAVPEAIDREIARLKLKSMGYEIDTLTEEQVKYLASWKSGT

📊 Sample Types

Isolate 17.5%
Metagenome 82.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 45.9%
Termitidae 21.6%
Kalotermitidae 18.9%
Termopsidae 5.4%
Rhinotermitidae 4.1%
Passalidae 1.4%
Formicidae 1.4%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 2
Bacteria 173
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
2 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
3 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
4 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 2820942695 Unclassified Actinobacteria Cu122P5bin37 Isolate Unclassified
15 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
16 642555172 Endomicrobium trichonymphae Rs-D17 Isolate Unclassified
17 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
18 2820939604 Unclassified Actinobacteria Emb289P1bin4 Isolate Unclassified
19 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
20 2820729191 Unclassified Chloroflexi Th196P4bin49 Isolate Unclassified
21 2820731983 Unclassified Chloroflexi Nt197P3bin126 Isolate Unclassified
22 2820734335 Unclassified Chloroflexi Lab288P3bin99 Isolate Unclassified
23 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
24 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
25 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
26 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
27 2820873081 Unclassified Actinobacteria Lab288P1bin96 Isolate Unclassified
28 2820907832 Unclassified Actinobacteria Emb289P4bin29 Isolate Unclassified
29 2772190889 Unclassified Elusimicrobia Cu122P5_bin43 Isolate Unclassified
30 2791354839 Unclassified Chloroflexi Co191P4bin10 Isolate Unclassified
31 2791354849 Unclassified Chloroflexi Lab288P3bin29 Isolate Unclassified
32 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
33 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
34 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
35 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
36 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
37 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
38 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
39 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
40 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
41 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
42 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
43 2820880921 Unclassified Actinobacteria Lab288P1bin60 Isolate Unclassified
44 2820893114 Unclassified Actinobacteria Lab288P1bin125 Isolate Unclassified
45 2820934415 Unclassified Actinobacteria Emb289P1bin68 Isolate Unclassified
46 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
47 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
48 2820403592 Unclassified Firmicutes Lab288P4bin93 Isolate Unclassified
49 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
50 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
51 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
52 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
53 2820833147 Unclassified Actinobacteria Lab288P4bin85 Isolate Unclassified
54 2820870086 Unclassified Actinobacteria Lab288P3bin107 Isolate Unclassified
55 2820906387 Unclassified Actinobacteria Emb289P4bin41 Isolate Unclassified
56 2821322763 Unclassified Actinobacteria Cu122P5bin19 Isolate Unclassified
57 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
58 2791354848 Unclassified Chloroflexi Emb289P3bin155 Isolate Unclassified
59 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
60 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
61 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
62 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
63 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
64 2820856540 Unclassified Actinobacteria Lab288P3bin21 Isolate Unclassified
65 2820940989 Unclassified Actinobacteria Emb289P1bin20 Isolate Unclassified
66 2772190891 Unclassified Elusimicrobia Emb289P1_bin41 Isolate Unclassified
67 2772190895 Unclassified Elusimicrobia Emb289P1_bin39 Isolate Unclassified
68 2820733257 Unclassified Chloroflexi Lab288P4bin59 Isolate Unclassified
69 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
70 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
71 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
72 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
73 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
74 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_150221 3300042612 Bacteria 86975
2 Ga0466705_190546 3300042612 Bacteria 10060
3 Ga0466690_023087 3300042590 Bacteria 6452
4 Ga0466691_213478 3300042593 Bacteria 5152
5 Ga0466696_415601 3300042596 Bacteria 9051
6 Ga0466714_032663 3300042603 Bacteria 59155
7 Ga0466716_290801 3300042605 Bacteria 1754
8 Ga0466715_331047 3300042616 Bacteria 6593
9 Ga0466723_092498 3300042618 Bacteria 13629
10 Ga0466723_340182 3300042618 Bacteria 3248
11 Ga0466723_367685 3300042618 Bacteria 22939
12 Ga0466728_406814 3300042620 Bacteria 2258
13 Ga0123356_10002894 3300010049 Bacteria 18186
14 Ga0123356_10059558 3300010049 Bacteria 3562
15 Ga0123354_10087679 3300010882 Unclassified 4336
16 Ga0466704_463811 3300042643 Bacteria 3487
17 Ga0466708_008067 3300042652 Bacteria 49835
18 JGI24705J35276_12238696 3300002504 Bacteria 38670
19 Ga0068302_10272649 3300005071 Bacteria 2565
20 Ga0466733_058503 3300042659 Bacteria 5436
21 Ga0466690_193780 3300042590 Bacteria 5941
22 Ga0466719_491287 3300042606 Bacteria 1907
23 Ga0466705_515927 3300042612 Bacteria 8320
24 Ga0466723_093023 3300042618 Archaea 6707
25 Ga0466723_232786 3300042618 Bacteria 4137
26 Ga0466728_165584 3300042620 Bacteria 25593
27 Ga0466729_005173 3300042621 Bacteria 17241
28 Ga0123357_10031185 3300009784 Bacteria 7233
29 Ga0123356_10034337 3300010049 Bacteria 4740
30 Ga0466703_407813 3300042636 Bacteria 118832
31 Ga0466708_204681 3300042652 Bacteria 111842
32 Ga0466705_178218 3300042612 Bacteria 21616
33 Ga0466696_257149 3300042596 Bacteria 5567
34 Ga0466706_155444 3300042599 Bacteria 3735
35 Ga0466717_235431 3300042604 Bacteria 1848
36 Ga0466723_123652 3300042618 Bacteria 16024
37 Ga0466723_180400 3300042618 Bacteria 3672
38 Ga0466726_342534 3300042619 Bacteria 5130
39 Ga0123355_10143128 3300009826 Bacteria 3652
40 Ga0123355_10222487 3300009826 Unclassified 2711
41 Ga0123356_10007223 3300010049 Bacteria 11110
42 Ga0123353_10010945 3300010167 Unclassified 12721
43 Ga0466735_234538 3300042624 Bacteria 15576
44 Ga0466703_059198 3300042636 Bacteria 12728
45 Ga0466704_159851 3300042643 Bacteria 2888
46 Ga0466704_228191 3300042643 Bacteria 3673
47 Ga0466709_324654 3300042648 Bacteria 3308
48 Ga0466700_389913 3300042600 Bacteria 2167
49 Ga0466713_035394 3300042602 Bacteria 62034
50 Ga0466716_171514 3300042605 Bacteria 9744
51 Ga0466716_181897 3300042605 Bacteria 2812
52 Ga0466719_435978 3300042606 Bacteria 4530
53 Ga0466711_233252 3300042615 Bacteria 9691
54 Ga0466715_144395 3300042616 Bacteria 42772
55 Ga0466715_445165 3300042616 Bacteria 1841
56 Ga0466723_063624 3300042618 Bacteria 32633
57 Ga0466723_125995 3300042618 Bacteria 41222
58 Ga0123353_10001172 3300010167 Bacteria 32006
59 Ga0123354_10017718 3300010882 Bacteria 11161
60 Ga0466704_028361 3300042643 Bacteria 18654
61 2227477706 2225789004 Bacteria 4566
62 Ga0466705_262734 3300042612 Bacteria 37553
63 Ga0466705_356271 3300042612 Bacteria 1510
64 Ga0466656_274446 3300042550 Bacteria 1817
65 Ga0466657_361226 3300042582 Bacteria 6005
66 Ga0466692_204980 3300042591 Bacteria 2618
67 Ga0466691_212247 3300042593 Unclassified 2638
68 Ga0466706_002209 3300042599 Bacteria 2087
69 Ga0466707_039849 3300042601 Bacteria 99110
70 Ga0466716_002899 3300042605 Bacteria 2702
71 Ga0466716_179235 3300042605 Bacteria 2991
72 Ga0466719_506687 3300042606 Bacteria 2376
73 Ga0466722_062339 3300042609 Bacteria 15817
74 Ga0466722_239735 3300042609 Bacteria 1370
75 Ga0466711_004089 3300042615 Bacteria 32226
76 Ga0466711_181895 3300042615 Bacteria 3435
77 Ga0466711_224592 3300042615 Bacteria 117488
78 Ga0466715_593323 3300042616 Bacteria 37439
79 Ga0466723_015824 3300042618 Bacteria 4937
80 Ga0123356_10001427 3300010049 Bacteria 26432
81 Ga0123353_10093569 3300010167 Bacteria 4843
82 Ga0466731_129529 3300042622 Bacteria 1723
83 Ga0466735_083747 3300042624 Bacteria 1672
84 Ga0466730_020158 3300042625 Bacteria 2297
85 Ga0466704_089014 3300042643 Bacteria 2607
86 Ga0466704_174348 3300042643 Bacteria 3272
87 Ga0466704_317186 3300042643 Unclassified 10032
88 Ga0466704_558407 3300042643 Bacteria 2001
89 Ga0466708_222599 3300042652 Bacteria 16575
90 Ga0466708_337235 3300042652 Bacteria 4487
91 JGI24702J35022_10004011 3300002462 Bacteria 8826
92 Ga0466705_269816 3300042612 Bacteria 17674
93 Ga0466691_088455 3300042593 Bacteria 17602
94 Ga0466713_097113 3300042602 Bacteria 48226
95 Ga0466716_361943 3300042605 Bacteria 1556
96 Ga0466722_083333 3300042609 Bacteria 55861
97 Ga0466705_428617 3300042612 Unclassified 12229
98 Ga0466715_271792 3300042616 Bacteria 4831
99 Ga0466715_574337 3300042616 Bacteria 4562
100 Ga0466715_622217 3300042616 Bacteria 2655
101 Ga0466723_119664 3300042618 Bacteria 9088
102 Ga0466726_077587 3300042619 Bacteria 39307
103 Ga0466726_395278 3300042619 Bacteria 1622
104 Ga0466729_186881 3300042621 Bacteria 7306
105 Ga0123357_10007296 3300009784 Unclassified 13641
106 Ga0123356_10014194 3300010049 Bacteria 7662
107 Ga0123353_10027784 3300010167 Bacteria 8677
108 Ga0123354_10155410 3300010882 Bacteria 2747
109 Ga0466704_566659 3300042643 Bacteria 2463
110 Ga0466709_180278 3300042648 Bacteria 4190
111 Ga0466727_006635 3300042655 Bacteria 14956
112 JGI24702J35022_10039862 3300002462 Bacteria 2506
113 Ga0466705_151951 3300042612 Unclassified 15959
114 Ga0466705_327500 3300042612 Bacteria 20390
115 Ga0466719_106003 3300042606 Bacteria 17232
116 Ga0466711_325880 3300042615 Unclassified 18268
117 Ga0466715_096224 3300042616 Unclassified 5850
118 Ga0466715_623361 3300042616 Bacteria 6097
119 Ga0466723_296224 3300042618 Archaea 4922
120 Ga0466723_318515 3300042618 Bacteria 4725
121 Ga0466723_338195 3300042618 Unclassified 3839
122 Ga0466728_347310 3300042620 Unclassified 9307
123 Ga0466728_477692 3300042620 Bacteria 2225
124 Ga0123355_10000111 3300009826 Bacteria 91183
125 Ga0123355_10000744 3300009826 Bacteria 44411
126 Ga0123355_10007714 3300009826 Bacteria 16169
127 Ga0123355_10035451 3300009826 Unclassified 8108
128 Ga0123356_10123292 3300010049 Bacteria 2525
129 Ga0123353_10025195 3300010167 Bacteria 9056
130 Ga0123353_10080099 3300010167 Bacteria 5253
131 Ga0123353_10422066 3300010167 Bacteria 1976
132 Ga0466729_253898 3300042621 Bacteria 37673
133 Ga0466709_185139 3300042648 Bacteria 2058
134 Ga0466708_033771 3300042652 Bacteria 71688
135 Ga0466691_072180 3300042593 Bacteria 5167
136 Ga0466706_129705 3300042599 Bacteria 95744
137 Ga0466723_147826 3300042618 Bacteria 8985
138 Ga0466728_321460 3300042620 Bacteria 13543
139 Ga0123357_10127401 3300009784 Bacteria 3184
140 Ga0123355_10000876 3300009826 Bacteria 41618
141 Ga0123355_10003645 3300009826 Bacteria 22187
142 Ga0123355_10187405 3300009826 Unclassified 3056
143 Ga0123353_10102136 3300010167 Bacteria 4622
144 Ga0123353_10242187 3300010167 Bacteria 2801
145 Ga0123354_10001235 3300010882 Bacteria 30314
146 Ga0123354_10023778 3300010882 Bacteria 9662
147 Ga0466731_085033 3300042622 Bacteria 2043
148 Ga0466735_049486 3300042624 Bacteria 20553
149 Ga0466735_066743 3300042624 Bacteria 5919
150 Ga0466703_311623 3300042636 Bacteria 7012
151 Ga0466703_406352 3300042636 Bacteria 10089
152 Ga0466704_098294 3300042643 Bacteria 3276
153 Ga0466708_009376 3300042652 Bacteria 5476
154 JGI24696J40584_12957999 3300002834 Bacteria 3816
155 Ga0123357_10002867 3300009784 Bacteria 19437
156 Ga0123357_10002877 3300009784 Bacteria 19403

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00670 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD binding domain 278 438 0.99
PF05221 AdoHcyase S-adenosyl-L-homocysteine hydrolase 232 508 0.97
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 295 388 0.87

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02826 GO:0051287 NAD binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.