Protein Family IF04834
Metagenome
Isolate
200
Members
59
Samples
187
Scaffolds
270.84
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_021448|Ga0466691_021448_3226_4179
- Length
- 317 aa
- Sequence
- LEKPVKSPGFSLKSKEAVPKTEVLEQPHRKNFPMLFHFCGTWGYSSVMSIFEAVILGAVQGITEFLPVSSSGHLVLFQRIFGVSGDNLLFDTLVHGGTLIAVFIVLWKDIRAILKRIVQPLTAYLILGTIPAVIAALLFDETIERAFSTGSFLGFAFLITAALLFSPEILNIYRQKQRGLVQTKKMDRLDALIIGILQAIAIIPGVSRSGSTLSGALFRRLDRDFAARFSFLLSIPAILGALVLQTKDLLGGTGAPETGISPAALIAGVLTAAIVGFFSIRLMLKIVRERSLLGFAAYTAILGILILIDQLFSHIFF
Sample Types
Isolate
6.5%
Metagenome
93.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.2%
Unclassified
25.9%
Kalotermitidae
24.1%
Rhinotermitidae
6.9%
Termopsidae
5.2%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
191
Eukaryota
0
Viruses
1
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 2 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 3 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 4 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 5 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 6 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 7 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 8 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 9 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 10 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 11 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 12 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 16 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 17 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 18 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 19 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 20 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 21 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 26 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 27 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 30 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 31 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 32 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 46 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 47 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 48 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 49 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 50 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 51 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 52 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 53 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 54 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 55 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 56 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 57 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 58 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 59 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466720_068932 | 3300042607 | Bacteria | 16443 |
| 2 | JGI24698J34947_10033326 | 3300002449 | Bacteria | 2703 |
| 3 | Ga0466705_115912 | 3300042612 | Bacteria | 13386 |
| 4 | Ga0466731_203893 | 3300042622 | Bacteria | 1560 |
| 5 | Ga0466704_348801 | 3300042643 | Bacteria | 47812 |
| 6 | Ga0466727_343450 | 3300042655 | Bacteria | 1819 |
| 7 | Ga0123356_10039038 | 3300010049 | Bacteria | 4424 |
| 8 | Ga0123353_10051308 | 3300010167 | Bacteria | 6581 |
| 9 | Ga0123353_10441870 | 3300010167 | Bacteria | 1919 |
| 10 | Ga0466715_596035 | 3300042616 | Bacteria | 5685 |
| 11 | Ga0466718_006196 | 3300042617 | Bacteria | 7709 |
| 12 | Ga0466718_064165 | 3300042617 | Bacteria | 1152 |
| 13 | Ga0466723_161149 | 3300042618 | Bacteria | 7745 |
| 14 | Ga0466692_010681 | 3300042591 | Bacteria | 32497 |
| 15 | Ga0466692_067266 | 3300042591 | Bacteria | 3362 |
| 16 | Ga0466691_038353 | 3300042593 | Bacteria | 2110 |
| 17 | Ga0466691_166022 | 3300042593 | Bacteria | 7212 |
| 18 | Ga0466694_038740 | 3300042594 | Bacteria | 1003 |
| 19 | Ga0466694_282771 | 3300042594 | Bacteria | 4295 |
| 20 | Ga0466696_055375 | 3300042596 | Bacteria | 12993 |
| 21 | Ga0466696_373671 | 3300042596 | Bacteria | 1880 |
| 22 | Ga0466696_487737 | 3300042596 | Bacteria | 2644 |
| 23 | Ga0466699_232177 | 3300042597 | Bacteria | 1195 |
| 24 | Ga0466699_347501 | 3300042597 | Bacteria | 6757 |
| 25 | Ga0466717_179779 | 3300042604 | Bacteria | 2121 |
| 26 | Ga0466720_082542 | 3300042607 | Bacteria | 14402 |
| 27 | JGI24695J34938_10001889 | 3300002450 | Bacteria | 16968 |
| 28 | JGI24695J34938_10002598 | 3300002450 | Bacteria | 13596 |
| 29 | JGI24699J35502_11101212 | 3300002509 | Bacteria | 2369 |
| 30 | Ga0072940_1016987 | 3300005200 | Bacteria | 1709 |
| 31 | Ga0466705_058111 | 3300042612 | Bacteria | 3227 |
| 32 | Ga0466729_291800 | 3300042621 | Bacteria | 1331 |
| 33 | Ga0466731_040968 | 3300042622 | Bacteria | 19783 |
| 34 | Ga0466731_407025 | 3300042622 | Bacteria | 18384 |
| 35 | Ga0466702_401041 | 3300042635 | Bacteria | 10872 |
| 36 | Ga0466703_117188 | 3300042636 | Bacteria | 3754 |
| 37 | Ga0466704_504100 | 3300042643 | Bacteria | 25621 |
| 38 | Ga0466709_032333 | 3300042648 | Bacteria | 2204 |
| 39 | Ga0466709_063115 | 3300042648 | Bacteria | 14736 |
| 40 | Ga0466708_417698 | 3300042652 | Bacteria | 2386 |
| 41 | Ga0466712_055221 | 3300042614 | Bacteria | 1537 |
| 42 | Ga0466718_093921 | 3300042617 | Bacteria | 1423 |
| 43 | Ga0466723_025256 | 3300042618 | Bacteria | 10959 |
| 44 | Ga0415639_086514 | 3300038395 | Bacteria | 6128 |
| 45 | Ga0466690_045186 | 3300042590 | Bacteria | 2352 |
| 46 | Ga0466690_158322 | 3300042590 | Bacteria | 5258 |
| 47 | Ga0466691_045961 | 3300042593 | Bacteria | 3232 |
| 48 | Ga0466706_233155 | 3300042599 | Bacteria | 1148 |
| 49 | Ga0466719_340751 | 3300042606 | Bacteria | 2225 |
| 50 | Ga0466722_091200 | 3300042609 | Bacteria | 4363 |
| 51 | Ga0466722_246010 | 3300042609 | Bacteria | 3902 |
| 52 | JGI24695J34938_10028133 | 3300002450 | Viruses | 2645 |
| 53 | Ga0466704_111914 | 3300042643 | Bacteria | 32572 |
| 54 | Ga0466708_027480 | 3300042652 | Bacteria | 3605 |
| 55 | Ga0466727_239122 | 3300042655 | Bacteria | 3650 |
| 56 | Ga0466712_191566 | 3300042614 | Bacteria | 26176 |
| 57 | Ga0466715_312030 | 3300042616 | Bacteria | 23301 |
| 58 | Ga0466718_000905 | 3300042617 | Bacteria | 1190 |
| 59 | Ga0466718_061328 | 3300042617 | Bacteria | 3251 |
| 60 | Ga0466718_133661 | 3300042617 | Bacteria | 1933 |
| 61 | Ga0466723_195288 | 3300042618 | Bacteria | 39093 |
| 62 | Ga0466728_006285 | 3300042620 | Bacteria | 1801 |
| 63 | Ga0466692_015113 | 3300042591 | Bacteria | 2273 |
| 64 | Ga0466692_153387 | 3300042591 | Bacteria | 12822 |
| 65 | Ga0466691_021448 | 3300042593 | Bacteria | 7406 |
| 66 | Ga0466691_090638 | 3300042593 | Bacteria | 7476 |
| 67 | Ga0466696_416393 | 3300042596 | Bacteria | 2178 |
| 68 | Ga0466699_036517 | 3300042597 | Bacteria | 13115 |
| 69 | Ga0466732_027608 | 3300042656 | Bacteria | 1591 |
| 70 | Ga0466701_094391 | 3300042598 | Bacteria | 1880 |
| 71 | Ga0466716_467190 | 3300042605 | Bacteria | 4435 |
| 72 | Ga0466721_228806 | 3300042608 | Bacteria | 8618 |
| 73 | JGI24695J34938_10014142 | 3300002450 | Bacteria | 4153 |
| 74 | Ga0072941_1000379 | 3300005201 | Bacteria | 3200 |
| 75 | Ga0466703_094985 | 3300042636 | Bacteria | 7068 |
| 76 | Ga0466703_109633 | 3300042636 | Bacteria | 3347 |
| 77 | Ga0466704_466222 | 3300042643 | Bacteria | 45364 |
| 78 | Ga0466704_558775 | 3300042643 | Bacteria | 5563 |
| 79 | Ga0466709_414761 | 3300042648 | Bacteria | 1140 |
| 80 | Ga0466708_310163 | 3300042652 | Bacteria | 2678 |
| 81 | Ga0123355_10639464 | 3300009826 | Bacteria | 1246 |
| 82 | Ga0123356_10000080 | 3300010049 | Bacteria | 102921 |
| 83 | Ga0466712_002362 | 3300042614 | Bacteria | 5758 |
| 84 | Ga0466723_010092 | 3300042618 | Bacteria | 7890 |
| 85 | Ga0466726_059475 | 3300042619 | Bacteria | 1556 |
| 86 | Ga0466726_163129 | 3300042619 | Bacteria | 1196 |
| 87 | Ga0466729_094858 | 3300042621 | Bacteria | 1761 |
| 88 | Ga0466690_109368 | 3300042590 | Bacteria | 5760 |
| 89 | Ga0466691_001242 | 3300042593 | Bacteria | 9376 |
| 90 | Ga0466696_212094 | 3300042596 | Bacteria | 1258 |
| 91 | Ga0466696_334284 | 3300042596 | Bacteria | 2034 |
| 92 | Ga0466699_094678 | 3300042597 | Bacteria | 2999 |
| 93 | Ga0466732_063778 | 3300042656 | Bacteria | 4375 |
| 94 | Ga0466706_192476 | 3300042599 | Bacteria | 4606 |
| 95 | Ga0466716_089700 | 3300042605 | Bacteria | 11686 |
| 96 | Ga0466719_035370 | 3300042606 | Bacteria | 14737 |
| 97 | Ga0068305_10932015 | 3300005083 | Bacteria | 2366 |
| 98 | Ga0072940_1005367 | 3300005200 | Bacteria | 1884 |
| 99 | Ga0466705_262302 | 3300042612 | Bacteria | 5903 |
| 100 | Ga0466703_055737 | 3300042636 | Unclassified | 5842 |
| 101 | Ga0466703_083459 | 3300042636 | Bacteria | 27650 |
| 102 | Ga0466703_381679 | 3300042636 | Bacteria | 3976 |
| 103 | Ga0466704_027237 | 3300042643 | Bacteria | 12884 |
| 104 | Ga0466709_081209 | 3300042648 | Bacteria | 1623 |
| 105 | Ga0466711_360410 | 3300042615 | Bacteria | 21261 |
| 106 | Ga0466718_032349 | 3300042617 | Bacteria | 2861 |
| 107 | Ga0415639_179398 | 3300038395 | Unclassified | 2096 |
| 108 | Ga0466690_059424 | 3300042590 | Bacteria | 1772 |
| 109 | Ga0466690_340443 | 3300042590 | Bacteria | 1871 |
| 110 | Ga0466692_008511 | 3300042591 | Bacteria | 9096 |
| 111 | Ga0466699_024773 | 3300042597 | Bacteria | 8055 |
| 112 | Ga0466699_053177 | 3300042597 | Bacteria | 1665 |
| 113 | Ga0466699_315824 | 3300042597 | Bacteria | 1310 |
| 114 | Ga0466706_237678 | 3300042599 | Bacteria | 33551 |
| 115 | Ga0466713_101797 | 3300042602 | Bacteria | 6622 |
| 116 | JGI24695J34938_10000235 | 3300002450 | Bacteria | 52917 |
| 117 | JGI24695J34938_10005849 | 3300002450 | Bacteria | 7565 |
| 118 | JGI24702J35022_10004827 | 3300002462 | Bacteria | 7965 |
| 119 | Ga0466705_116163 | 3300042612 | Bacteria | 7755 |
| 120 | Ga0466705_321963 | 3300042612 | Bacteria | 1133 |
| 121 | Ga0466704_144043 | 3300042643 | Bacteria | 2655 |
| 122 | Ga0466704_450142 | 3300042643 | Bacteria | 1094 |
| 123 | Ga0466709_398520 | 3300042648 | Bacteria | 5019 |
| 124 | Ga0123355_10000238 | 3300009826 | Bacteria | 70491 |
| 125 | Ga0123353_11529101 | 3300010167 | Bacteria | 848 |
| 126 | Ga0466712_182291 | 3300042614 | Bacteria | 19649 |
| 127 | Ga0466711_094269 | 3300042615 | Bacteria | 8233 |
| 128 | Ga0466711_505594 | 3300042615 | Bacteria | 1299 |
| 129 | Ga0466715_165766 | 3300042616 | Bacteria | 7401 |
| 130 | Ga0466718_100539 | 3300042617 | Bacteria | 1989 |
| 131 | Ga0466723_137326 | 3300042618 | Bacteria | 3446 |
| 132 | Ga0466723_199520 | 3300042618 | Bacteria | 34473 |
| 133 | Ga0466723_241935 | 3300042618 | Bacteria | 1468 |
| 134 | Ga0456237_0012282 | 3300041968 | Bacteria | 1240 |
| 135 | Ga0466690_242409 | 3300042590 | Bacteria | 5688 |
| 136 | Ga0466690_346846 | 3300042590 | Bacteria | 2401 |
| 137 | Ga0466699_043568 | 3300042597 | Unclassified | 1827 |
| 138 | Ga0466699_052943 | 3300042597 | Bacteria | 1334 |
| 139 | Ga0466699_268116 | 3300042597 | Bacteria | 2519 |
| 140 | Ga0466713_015200 | 3300042602 | Bacteria | 2674 |
| 141 | Ga0466716_126202 | 3300042605 | Bacteria | 3228 |
| 142 | Ga0466716_266500 | 3300042605 | Bacteria | 4608 |
| 143 | Ga0466719_236213 | 3300042606 | Bacteria | 1706 |
| 144 | JGI24698J34947_10027205 | 3300002449 | Bacteria | 3035 |
| 145 | JGI24698J34947_10104373 | 3300002449 | Bacteria | 1266 |
| 146 | JGI24695J34938_10023600 | 3300002450 | Unclassified | 2963 |
| 147 | Ga0072941_1013073 | 3300005201 | Bacteria | 2142 |
| 148 | Ga0466703_259327 | 3300042636 | Bacteria | 6193 |
| 149 | Ga0466704_163942 | 3300042643 | Bacteria | 2317 |
| 150 | Ga0466708_180162 | 3300042652 | Bacteria | 3024 |
| 151 | Ga0466727_187068 | 3300042655 | Bacteria | 2562 |
| 152 | Ga0123356_10368136 | 3300010049 | Bacteria | 1566 |
| 153 | Ga0123353_10079344 | 3300010167 | Bacteria | 5276 |
| 154 | Ga0466712_322456 | 3300042614 | Bacteria | 5454 |
| 155 | Ga0466715_330326 | 3300042616 | Bacteria | 7433 |
| 156 | Ga0466718_013134 | 3300042617 | Bacteria | 11259 |
| 157 | Ga0466718_016719 | 3300042617 | Bacteria | 8126 |
| 158 | Ga0466718_074975 | 3300042617 | Bacteria | 9215 |
| 159 | Ga0466726_474216 | 3300042619 | Bacteria | 1140 |
| 160 | Ga0466729_081591 | 3300042621 | Unclassified | 1567 |
| 161 | Ga0466690_239775 | 3300042590 | Bacteria | 2444 |
| 162 | Ga0466694_020493 | 3300042594 | Bacteria | 2054 |
| 163 | Ga0466699_127726 | 3300042597 | Unclassified | 1427 |
| 164 | Ga0466732_005329 | 3300042656 | Unclassified | 1735 |
| 165 | Ga0466716_517077 | 3300042605 | Bacteria | 3496 |
| 166 | Ga0466720_234261 | 3300042607 | Bacteria | 7285 |
| 167 | JGI24695J34938_10032021 | 3300002450 | Bacteria | 2433 |
| 168 | Ga0123357_10000270 | 3300009784 | Bacteria | 49669 |
| 169 | Ga0466705_156988 | 3300042612 | Bacteria | 5266 |
| 170 | Ga0466705_359269 | 3300042612 | Bacteria | 23499 |
| 171 | Ga0466735_119413 | 3300042624 | Bacteria | 7864 |
| 172 | Ga0466702_407176 | 3300042635 | Bacteria | 2288 |
| 173 | Ga0466709_017463 | 3300042648 | Bacteria | 28555 |
| 174 | Ga0466727_083634 | 3300042655 | Bacteria | 4569 |
| 175 | Ga0123355_10252746 | 3300009826 | Bacteria | 2478 |
| 176 | Ga0123356_10113863 | 3300010049 | Bacteria | 2618 |
| 177 | Ga0466715_201015 | 3300042616 | Bacteria | 1891 |
| 178 | Ga0466718_129258 | 3300042617 | Bacteria | 9781 |
| 179 | Ga0466718_151976 | 3300042617 | Bacteria | 1019 |
| 180 | Ga0466723_156064 | 3300042618 | Bacteria | 4196 |
| 181 | Ga0466728_251357 | 3300042620 | Bacteria | 1470 |
| 182 | Ga0415639_061474 | 3300038395 | Unclassified | 1589 |
| 183 | Ga0466690_106083 | 3300042590 | Bacteria | 13825 |
| 184 | Ga0466692_013235 | 3300042591 | Bacteria | 10804 |
| 185 | Ga0466692_073694 | 3300042591 | Bacteria | 1930 |
| 186 | Ga0466692_165864 | 3300042591 | Bacteria | 11257 |
| 187 | Ga0466692_180592 | 3300042591 | Bacteria | 2638 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02673 | BacA | Bacitracin resistance protein BacA | 53 | 305 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.