Protein Family IF04816
Metagenome
224
Members
47
Samples
222
Scaffolds
270.69
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_007761|Ga0466691_007761_1019_1903
- Length
- 294 aa
- Sequence
- VVIVSGFHAFRFSPYSKEGVVKTPLSYYGGKQTLAKIILGLIPPHRLYCEPFLGGAAIFFAKEPSKVEIINDTNGELVNFYEVLQRDFTALEKEVVISLHSRSRHRQARVVYENPDMFDRVRRAWAIWLLANSSYGCMLDSGFGYDRTGGTSKKMATKRAGFSIDYAVRLQRVQIECCDALKIIRSRDCQDAFFYLDPPYVGSDQGHYDGYTQEDFDALLGLLEGIQGKFLLSSFRNKSLTNYTKRNDWHTLELKMASSMTHGYKTQRGKAEVLTANYPIKAPAKALKESPEKA
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.7%
Kalotermitidae
31.1%
Rhinotermitidae
8.9%
Termopsidae
6.7%
Unclassified
4.4%
Hodotermitidae
2.2%
Taxonomy
Archaea
1
Bacteria
203
Eukaryota
0
Viruses
1
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 44 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_059253 | 3300042612 | Bacteria | 2372 |
| 2 | Ga0466705_079480 | 3300042612 | Bacteria | 2363 |
| 3 | Ga0466733_103888 | 3300042659 | Bacteria | 2950 |
| 4 | Ga0466705_463494 | 3300042612 | Bacteria | 1177 |
| 5 | Ga0466705_516548 | 3300042612 | Bacteria | 1187 |
| 6 | Ga0466723_139884 | 3300042618 | Bacteria | 2781 |
| 7 | Ga0466726_253364 | 3300042619 | Bacteria | 1124 |
| 8 | Ga0466726_384257 | 3300042619 | Bacteria | 2032 |
| 9 | Ga0466728_005851 | 3300042620 | Bacteria | 1201 |
| 10 | Ga0466728_006585 | 3300042620 | Bacteria | 2152 |
| 11 | Ga0466728_130570 | 3300042620 | Unclassified | 3474 |
| 12 | Ga0466728_197221 | 3300042620 | Bacteria | 30113 |
| 13 | Ga0466728_296190 | 3300042620 | Bacteria | 1447 |
| 14 | Ga0466700_373556 | 3300042600 | Bacteria | 1107 |
| 15 | Ga0466713_129983 | 3300042602 | Bacteria | 1020 |
| 16 | Ga0466716_126349 | 3300042605 | Unclassified | 3404 |
| 17 | Ga0466735_181459 | 3300042624 | Bacteria | 65106 |
| 18 | Ga0466703_041141 | 3300042636 | Bacteria | 2030 |
| 19 | Ga0466703_430811 | 3300042636 | Bacteria | 1471 |
| 20 | Ga0466704_014024 | 3300042643 | Bacteria | 1039 |
| 21 | Ga0466704_038198 | 3300042643 | Bacteria | 4567 |
| 22 | Ga0466704_083031 | 3300042643 | Bacteria | 1146 |
| 23 | Ga0466704_146234 | 3300042643 | Bacteria | 2542 |
| 24 | Ga0466704_455605 | 3300042643 | Archaea | 1150 |
| 25 | Ga0466709_349575 | 3300042648 | Bacteria | 1192 |
| 26 | Ga0466691_152581 | 3300042593 | Bacteria | 34751 |
| 27 | Ga0466696_043853 | 3300042596 | Bacteria | 4278 |
| 28 | Ga0466696_086819 | 3300042596 | Bacteria | 2266 |
| 29 | Ga0466705_286447 | 3300042612 | Bacteria | 3449 |
| 30 | Ga0466712_078001 | 3300042614 | Bacteria | 4134 |
| 31 | Ga0466711_412720 | 3300042615 | Bacteria | 2016 |
| 32 | Ga0466715_269245 | 3300042616 | Unclassified | 10634 |
| 33 | Ga0466715_318987 | 3300042616 | Bacteria | 2078 |
| 34 | Ga0466715_353664 | 3300042616 | Bacteria | 1256 |
| 35 | Ga0466726_205798 | 3300042619 | Bacteria | 11650 |
| 36 | Ga0466728_023807 | 3300042620 | Bacteria | 9605 |
| 37 | Ga0466728_066803 | 3300042620 | Bacteria | 1699 |
| 38 | Ga0466728_479977 | 3300042620 | Bacteria | 3230 |
| 39 | AustNasuHG_c1003016 | 3300000089 | Bacteria | 6076 |
| 40 | JGI24698J34947_10030069 | 3300002449 | Unclassified | 2866 |
| 41 | JGI24702J35022_10051229 | 3300002462 | Unclassified | 2200 |
| 42 | Ga0072940_1027333 | 3300005200 | Unclassified | 3772 |
| 43 | Ga0123356_10127604 | 3300010049 | Bacteria | 2486 |
| 44 | Ga0466714_156180 | 3300042603 | Bacteria | 7399 |
| 45 | Ga0466716_292452 | 3300042605 | Bacteria | 2290 |
| 46 | Ga0466716_326997 | 3300042605 | Bacteria | 1234 |
| 47 | Ga0466716_352152 | 3300042605 | Bacteria | 1893 |
| 48 | Ga0466719_033868 | 3300042606 | Bacteria | 3646 |
| 49 | Ga0466722_056121 | 3300042609 | Bacteria | 6232 |
| 50 | Ga0466729_217684 | 3300042621 | Bacteria | 4768 |
| 51 | Ga0466703_075933 | 3300042636 | Bacteria | 3597 |
| 52 | Ga0466704_043039 | 3300042643 | Bacteria | 3506 |
| 53 | Ga0466704_096562 | 3300042643 | Bacteria | 17848 |
| 54 | Ga0466704_139802 | 3300042643 | Bacteria | 6766 |
| 55 | Ga0466704_342805 | 3300042643 | Bacteria | 1299 |
| 56 | Ga0466709_327924 | 3300042648 | Bacteria | 1264 |
| 57 | Ga0466727_229947 | 3300042655 | Bacteria | 39176 |
| 58 | Ga0466690_106148 | 3300042590 | Bacteria | 1457 |
| 59 | Ga0466696_116128 | 3300042596 | Bacteria | 1529 |
| 60 | Ga0466732_052490 | 3300042656 | Bacteria | 1749 |
| 61 | Ga0466732_316651 | 3300042656 | Bacteria | 1084 |
| 62 | Ga0466712_007754 | 3300042614 | Bacteria | 20258 |
| 63 | Ga0466712_311465 | 3300042614 | Bacteria | 1239 |
| 64 | Ga0466723_028044 | 3300042618 | Bacteria | 18854 |
| 65 | Ga0466726_151662 | 3300042619 | Bacteria | 28145 |
| 66 | Ga0466726_208503 | 3300042619 | Bacteria | 1174 |
| 67 | AustNasuHG_c1000662 | 3300000089 | Bacteria | 12231 |
| 68 | AustNasuHG_c1013908 | 3300000089 | Unclassified | 2750 |
| 69 | JGI24698J34947_10037480 | 3300002449 | Bacteria | 2519 |
| 70 | JGI24695J34938_10014263 | 3300002450 | Bacteria | 4129 |
| 71 | JGI24695J34938_10066906 | 3300002450 | Bacteria | 1513 |
| 72 | Ga0123353_10223838 | 3300010167 | Bacteria | 2939 |
| 73 | Ga0466706_120699 | 3300042599 | Bacteria | 27099 |
| 74 | Ga0466700_085045 | 3300042600 | Bacteria | 1019 |
| 75 | Ga0466719_122073 | 3300042606 | Bacteria | 2120 |
| 76 | Ga0466722_017089 | 3300042609 | Bacteria | 5639 |
| 77 | Ga0466722_090221 | 3300042609 | Bacteria | 7600 |
| 78 | Ga0466729_282565 | 3300042621 | Bacteria | 2236 |
| 79 | Ga0466703_297339 | 3300042636 | Bacteria | 1646 |
| 80 | Ga0466704_082507 | 3300042643 | Bacteria | 5445 |
| 81 | Ga0466704_110018 | 3300042643 | Bacteria | 4519 |
| 82 | Ga0466704_205727 | 3300042643 | Bacteria | 4595 |
| 83 | Ga0415639_121822 | 3300038395 | Bacteria | 2009 |
| 84 | Ga0466691_048387 | 3300042593 | Bacteria | 25592 |
| 85 | Ga0466701_001422 | 3300042598 | Bacteria | 1112 |
| 86 | Ga0466705_018619 | 3300042612 | Bacteria | 2254 |
| 87 | Ga0466705_490329 | 3300042612 | Bacteria | 1461 |
| 88 | Ga0466711_016742 | 3300042615 | Bacteria | 4623 |
| 89 | Ga0466718_069585 | 3300042617 | Bacteria | 44279 |
| 90 | Ga0466723_092878 | 3300042618 | Bacteria | 27354 |
| 91 | Ga0466728_271132 | 3300042620 | Bacteria | 11957 |
| 92 | AustNasuHG_c1000358 | 3300000089 | Bacteria | 15816 |
| 93 | Ga0123355_10718163 | 3300009826 | Bacteria | 1141 |
| 94 | Ga0466706_005315 | 3300042599 | Bacteria | 1590 |
| 95 | Ga0466706_141980 | 3300042599 | Bacteria | 1356 |
| 96 | Ga0466720_031672 | 3300042607 | Bacteria | 51216 |
| 97 | Ga0466731_315042 | 3300042622 | Bacteria | 1209 |
| 98 | Ga0466704_286001 | 3300042643 | Bacteria | 16185 |
| 99 | Ga0466704_558488 | 3300042643 | Bacteria | 1398 |
| 100 | Ga0466709_183496 | 3300042648 | Bacteria | 5863 |
| 101 | Ga0466708_219377 | 3300042652 | Bacteria | 2519 |
| 102 | Ga0466708_380141 | 3300042652 | Bacteria | 26708 |
| 103 | Ga0466690_134317 | 3300042590 | Bacteria | 1622 |
| 104 | Ga0466692_092815 | 3300042591 | Bacteria | 12598 |
| 105 | Ga0466693_346534 | 3300042592 | Unclassified | 5883 |
| 106 | Ga0466691_007761 | 3300042593 | Unclassified | 4762 |
| 107 | Ga0466691_054827 | 3300042593 | Bacteria | 18966 |
| 108 | Ga0466691_163568 | 3300042593 | Bacteria | 3513 |
| 109 | Ga0466694_090126 | 3300042594 | Bacteria | 2212 |
| 110 | Ga0466694_182988 | 3300042594 | Bacteria | 1277 |
| 111 | Ga0466694_391082 | 3300042594 | Bacteria | 2592 |
| 112 | Ga0466696_130405 | 3300042596 | Bacteria | 3724 |
| 113 | Ga0466696_255694 | 3300042596 | Bacteria | 1166 |
| 114 | Ga0466699_018763 | 3300042597 | Bacteria | 1387 |
| 115 | Ga0466705_044258 | 3300042612 | Bacteria | 1613 |
| 116 | Ga0466705_369797 | 3300042612 | Bacteria | 1275 |
| 117 | Ga0466732_019107 | 3300042656 | Bacteria | 2996 |
| 118 | Ga0466705_399885 | 3300042612 | Bacteria | 1783 |
| 119 | Ga0466711_163448 | 3300042615 | Bacteria | 15726 |
| 120 | Ga0466711_474835 | 3300042615 | Bacteria | 2320 |
| 121 | Ga0466711_511973 | 3300042615 | Bacteria | 13222 |
| 122 | Ga0466715_401794 | 3300042616 | Unclassified | 2577 |
| 123 | Ga0466718_081469 | 3300042617 | Bacteria | 1772 |
| 124 | Ga0466728_170138 | 3300042620 | Bacteria | 6579 |
| 125 | Ga0466728_191984 | 3300042620 | Bacteria | 12576 |
| 126 | JGI24695J34938_10014781 | 3300002450 | Bacteria | 4028 |
| 127 | Ga0072940_1086421 | 3300005200 | Unclassified | 1609 |
| 128 | Ga0072941_1061841 | 3300005201 | Bacteria | 2893 |
| 129 | Ga0466701_055957 | 3300042598 | Bacteria | 1426 |
| 130 | Ga0466719_050722 | 3300042606 | Unclassified | 1586 |
| 131 | Ga0466722_093424 | 3300042609 | Bacteria | 1909 |
| 132 | Ga0466703_222508 | 3300042636 | Bacteria | 3169 |
| 133 | Ga0466704_579146 | 3300042643 | Bacteria | 1615 |
| 134 | Ga0466709_244398 | 3300042648 | Bacteria | 36570 |
| 135 | Ga0466709_333991 | 3300042648 | Bacteria | 2775 |
| 136 | Ga0264413_125716 | 3300024493 | Bacteria | 6146 |
| 137 | Ga0456237_0001782 | 3300041968 | Bacteria | 3469 |
| 138 | Ga0466691_095440 | 3300042593 | Bacteria | 2530 |
| 139 | Ga0466694_155323 | 3300042594 | Bacteria | 17637 |
| 140 | Ga0466696_128559 | 3300042596 | Bacteria | 2537 |
| 141 | Ga0466705_020281 | 3300042612 | Bacteria | 1085 |
| 142 | Ga0466733_155529 | 3300042659 | Bacteria | 6036 |
| 143 | Ga0466712_003177 | 3300042614 | Bacteria | 3657 |
| 144 | Ga0466715_322131 | 3300042616 | Bacteria | 4026 |
| 145 | Ga0466718_061463 | 3300042617 | Bacteria | 2623 |
| 146 | Ga0466726_175864 | 3300042619 | Bacteria | 1814 |
| 147 | Ga0466728_075348 | 3300042620 | Bacteria | 12175 |
| 148 | Ga0466728_305709 | 3300042620 | Bacteria | 4530 |
| 149 | JGI24695J34938_10006224 | 3300002450 | Bacteria | 7243 |
| 150 | JGI24695J34938_10109751 | 3300002450 | Bacteria | 1124 |
| 151 | Ga0466716_016397 | 3300042605 | Bacteria | 2128 |
| 152 | Ga0466716_021996 | 3300042605 | Bacteria | 1239 |
| 153 | Ga0466716_103683 | 3300042605 | Bacteria | 1862 |
| 154 | Ga0466716_164055 | 3300042605 | Bacteria | 1358 |
| 155 | Ga0466719_362749 | 3300042606 | Bacteria | 1491 |
| 156 | Ga0466722_214717 | 3300042609 | Bacteria | 2888 |
| 157 | Ga0466729_210217 | 3300042621 | Bacteria | 2088 |
| 158 | Ga0466703_366675 | 3300042636 | Bacteria | 3915 |
| 159 | Ga0466704_117188 | 3300042643 | Bacteria | 2855 |
| 160 | Ga0466727_069180 | 3300042655 | Bacteria | 4152 |
| 161 | Ga0466690_158881 | 3300042590 | Bacteria | 19336 |
| 162 | Ga0466693_198094 | 3300042592 | Bacteria | 2188 |
| 163 | Ga0466691_035993 | 3300042593 | Bacteria | 3699 |
| 164 | Ga0466691_167089 | 3300042593 | Bacteria | 3473 |
| 165 | Ga0466691_208990 | 3300042593 | Bacteria | 21465 |
| 166 | Ga0466694_039541 | 3300042594 | Bacteria | 1342 |
| 167 | Ga0466694_357249 | 3300042594 | Bacteria | 2838 |
| 168 | Ga0466718_025786 | 3300042617 | Unclassified | 5684 |
| 169 | Ga0466718_067425 | 3300042617 | Bacteria | 1370 |
| 170 | Ga0466728_112374 | 3300042620 | Bacteria | 1089 |
| 171 | JGI24698J34947_10074164 | 3300002449 | Bacteria | 1622 |
| 172 | Ga0072941_1001265 | 3300005201 | Bacteria | 59392 |
| 173 | Ga0123355_10168114 | 3300009826 | Bacteria | 3285 |
| 174 | Ga0466707_116056 | 3300042601 | Bacteria | 1870 |
| 175 | Ga0466713_031745 | 3300042602 | Bacteria | 1467 |
| 176 | Ga0466716_212179 | 3300042605 | Bacteria | 3927 |
| 177 | Ga0466719_569557 | 3300042606 | Bacteria | 1409 |
| 178 | Ga0466735_044254 | 3300042624 | Bacteria | 2365 |
| 179 | Ga0466704_030230 | 3300042643 | Bacteria | 7552 |
| 180 | Ga0466704_061618 | 3300042643 | Bacteria | 4345 |
| 181 | Ga0466709_000137 | 3300042648 | Bacteria | 1614 |
| 182 | Ga0466709_198973 | 3300042648 | Bacteria | 2078 |
| 183 | Ga0466709_210057 | 3300042648 | Bacteria | 1530 |
| 184 | Ga0466708_097886 | 3300042652 | Bacteria | 11786 |
| 185 | Ga0466708_239352 | 3300042652 | Bacteria | 15383 |
| 186 | Ga0264413_127763 | 3300024493 | Bacteria | 2470 |
| 187 | Ga0466690_097640 | 3300042590 | Bacteria | 1563 |
| 188 | Ga0466690_152323 | 3300042590 | Unclassified | 3436 |
| 189 | Ga0466691_122551 | 3300042593 | Bacteria | 9203 |
| 190 | Ga0466696_174159 | 3300042596 | Viruses | 6904 |
| 191 | Ga0466699_228048 | 3300042597 | Bacteria | 1183 |
| 192 | Ga0466705_077233 | 3300042612 | Bacteria | 1533 |
| 193 | Ga0466705_252112 | 3300042612 | Bacteria | 4693 |
| 194 | Ga0466705_328207 | 3300042612 | Bacteria | 2883 |
| 195 | Ga0466712_030931 | 3300042614 | Unclassified | 33192 |
| 196 | Ga0466715_386688 | 3300042616 | Bacteria | 3558 |
| 197 | Ga0466718_030339 | 3300042617 | Bacteria | 1422 |
| 198 | Ga0466723_099605 | 3300042618 | Bacteria | 4101 |
| 199 | Ga0466726_263143 | 3300042619 | Bacteria | 6734 |
| 200 | Ga0466728_016601 | 3300042620 | Bacteria | 2205 |
| 201 | Ga0466728_044688 | 3300042620 | Bacteria | 1100 |
| 202 | JGI24695J34938_10055612 | 3300002450 | Bacteria | 1709 |
| 203 | JGI24695J34938_10101130 | 3300002450 | Bacteria | 1178 |
| 204 | Ga0072940_1064393 | 3300005200 | Bacteria | 1017 |
| 205 | Ga0466707_057725 | 3300042601 | Bacteria | 2919 |
| 206 | Ga0466716_512407 | 3300042605 | Bacteria | 1694 |
| 207 | Ga0466731_069358 | 3300042622 | Bacteria | 5233 |
| 208 | Ga0466703_215705 | 3300042636 | Bacteria | 1732 |
| 209 | Ga0466703_251720 | 3300042636 | Bacteria | 1163 |
| 210 | Ga0466703_258834 | 3300042636 | Bacteria | 1477 |
| 211 | Ga0466704_181573 | 3300042643 | Bacteria | 8885 |
| 212 | Ga0466704_585683 | 3300042643 | Bacteria | 1554 |
| 213 | Ga0466691_007380 | 3300042593 | Bacteria | 11927 |
| 214 | Ga0466691_012953 | 3300042593 | Bacteria | 16228 |
| 215 | Ga0466691_099796 | 3300042593 | Unclassified | 15324 |
| 216 | Ga0466691_199399 | 3300042593 | Bacteria | 3240 |
| 217 | Ga0466694_019991 | 3300042594 | Bacteria | 6773 |
| 218 | Ga0466694_097309 | 3300042594 | Unclassified | 3853 |
| 219 | Ga0466694_135729 | 3300042594 | Bacteria | 1518 |
| 220 | Ga0466696_177244 | 3300042596 | Bacteria | 1115 |
| 221 | Ga0466696_405149 | 3300042596 | Bacteria | 1718 |
| 222 | Ga0466696_469388 | 3300042596 | Bacteria | 2556 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02086 | MethyltransfD12 | D12 class N6 adenine-specific DNA methyltransferase | 27 | 217 | 0.82 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.