Protein Family IF04795

Metagenome Isolate
157 Members
59 Samples
132 Scaffolds
244.65 Avg Length

🧬 Representative Sequence

ID
3300042592|Ga0466693_308039|Ga0466693_308039_275_1087
Length
270 aa
Sequence
MKAIILSAGYATRMYPLTENQPKALLPLRGKPVINYILDQIKLIPEIDAVYVVTNHKFYTHFCEWADAMNSRYASPVGKIPTSEYSASDTRRDFPEEGAGIPISVLNDGTLSNDDRRGAVGDVVFTIEEKNISDELFVIASDNFFTFDLREQLGIFRRTGCDTLAAMEMDDREKLKAFAVAQLDENGKVLHLEEKPAEPRSNTAIFASYFFRKETVPLFAKYLAEGNSSDNIGAFPAWLSKTQDIYAYKMNGECYDIGTIEMYERMNREG

📊 Sample Types

Isolate 15.9%
Metagenome 84.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 46.6%
Termitidae 37.9%
Kalotermitidae 10.3%
Hodotermitidae 1.7%
Passalidae 1.7%
Termopsidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 150
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
2 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
3 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
4 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
11 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
12 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
13 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
16 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
17 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
18 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
19 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
25 2820427814 Unclassified Firmicutes Lab288P3bin44 Isolate Unclassified
26 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
30 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
31 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
32 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
33 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
34 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
35 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
36 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
37 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
38 2820431532 Unclassified Firmicutes Lab288P3bin230 Isolate Unclassified
39 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
40 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
41 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
42 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
43 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
44 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
45 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
46 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
47 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
48 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
49 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
50 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
51 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
52 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
53 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
54 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
55 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
56 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
57 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
58 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
59 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_265627 3300042615 Bacteria 3778
2 Ga0123355_10000145 3300009826 Bacteria 84846
3 Ga0123355_10012251 3300009826 Bacteria 13277
4 Ga0123355_10036041 3300009826 Bacteria 8043
5 Ga0123355_10220555 3300009826 Unclassified 2728
6 Ga0123353_11144737 3300010167 Bacteria 1028
7 Ga0466706_060303 3300042599 Bacteria 2164
8 Ga0466706_195572 3300042599 Bacteria 16070
9 Ga0466700_154345 3300042600 Bacteria 1816
10 Ga0466719_085143 3300042606 Bacteria 1008
11 Ga0466734_107683 3300042623 Bacteria 1901
12 Ga0466704_210888 3300042643 Bacteria 37471
13 Ga0466727_093934 3300042655 Bacteria 1067
14 IMNBL1DRAFT_c0022137 3300000062 Bacteria 2523
15 JGI24695J34938_10025922 3300002450 Unclassified 2794
16 Ga0466699_077792 3300042597 Bacteria 4208
17 Ga0466705_367434 3300042612 Bacteria 38777
18 Ga0123355_10025890 3300009826 Bacteria 9454
19 Ga0123356_10008472 3300010049 Bacteria 10224
20 Ga0466706_012119 3300042599 Bacteria 3672
21 Ga0466716_179351 3300042605 Bacteria 2894
22 Ga0466693_009063 3300042592 Bacteria 3002
23 Ga0466693_010222 3300042592 Unclassified 1861
24 Ga0466733_199053 3300042659 Bacteria 1864
25 Ga0466711_085895 3300042615 Bacteria 12169
26 Ga0466715_236802 3300042616 Bacteria 28543
27 Ga0123357_10227530 3300009784 Bacteria 2053
28 Ga0123355_10000034 3300009826 Bacteria 138123
29 Ga0123355_10000708 3300009826 Bacteria 45250
30 Ga0123355_10016841 3300009826 Bacteria 11529
31 Ga0123355_10081686 3300009826 Bacteria 5157
32 Ga0123355_10258111 3300009826 Bacteria 2442
33 Ga0123355_10294356 3300009826 Bacteria 2222
34 Ga0123355_10610058 3300009826 Bacteria 1291
35 Ga0123356_10166136 3300010049 Bacteria 2211
36 Ga0123356_10965667 3300010049 Bacteria 1023
37 Ga0123354_10117960 3300010882 Bacteria 3449
38 Ga0466700_373334 3300042600 Bacteria 80469
39 IMNBL1DRAFT_c0000309 3300000062 Bacteria 41566
40 JGI24703J35330_11748639 3300002501 Unclassified 23075
41 Ga0466693_263932 3300042592 Bacteria 1427
42 Ga0466715_436850 3300042616 Bacteria 42055
43 Ga0123357_10176875 3300009784 Bacteria 2505
44 Ga0123357_10348416 3300009784 Bacteria 1421
45 Ga0123355_10002813 3300009826 Bacteria 24706
46 Ga0123355_10014872 3300009826 Bacteria 12187
47 Ga0123355_10415657 3300009826 Bacteria 1723
48 Ga0123355_10822514 3300009826 Bacteria 1030
49 Ga0123356_10168521 3300010049 Bacteria 2198
50 Ga0123353_10031551 3300010167 Bacteria 8209
51 Ga0466700_441892 3300042600 Bacteria 7281
52 Ga0466719_262752 3300042606 Bacteria 24996
53 Ga0466719_474706 3300042606 Bacteria 1329
54 JGI24702J35022_10001660 3300002462 Unclassified 13828
55 JGI24703J35330_11746661 3300002501 Bacteria 5494
56 Ga0068305_10003756 3300005083 Bacteria 8019
57 Ga0415639_023947 3300038395 Bacteria 14693
58 Ga0415639_099695 3300038395 Bacteria 1600
59 Ga0466710_266342 3300042613 Bacteria 3725
60 Ga0123355_10000137 3300009826 Bacteria 86760
61 Ga0123355_10000372 3300009826 Bacteria 57621
62 Ga0123355_10264964 3300009826 Bacteria 2397
63 Ga0123355_10535566 3300009826 Bacteria 1424
64 Ga0123353_10003289 3300010167 Bacteria 20399
65 Ga0123353_10681215 3300010167 Bacteria 1448
66 Ga0123354_10104266 3300010882 Bacteria 3805
67 Ga0466707_105169 3300042601 Bacteria 2296
68 JGI24695J34938_10051436 3300002450 Unclassified 1803
69 Ga0123357_10000423 3300009784 Bacteria 40429
70 Ga0415639_013489 3300038395 Bacteria 5009
71 Ga0415639_013490 3300038395 Bacteria 2506
72 Ga0415639_073945 3300038395 Bacteria 3825
73 Ga0466733_029540 3300042659 Bacteria 2298
74 Ga0466733_154586 3300042659 Bacteria 13215
75 Ga0123355_10018012 3300009826 Bacteria 11185
76 Ga0123355_10052005 3300009826 Bacteria 6647
77 Ga0123355_10054403 3300009826 Bacteria 6484
78 Ga0123355_10107517 3300009826 Bacteria 4369
79 Ga0123355_10497929 3300009826 Bacteria 1505
80 Ga0123355_10622087 3300009826 Unclassified 1272
81 Ga0123353_10125828 3300010167 Bacteria 4119
82 Ga0123353_10198118 3300010167 Bacteria 3163
83 Ga0123353_10230577 3300010167 Bacteria 2887
84 Ga0466714_043092 3300042603 Bacteria 6077
85 Ga0466714_168605 3300042603 Bacteria 1932
86 Ga0466721_177401 3300042608 Bacteria 1416
87 JGI24703J35330_11748356 3300002501 Bacteria 14559
88 JGI24703J35330_11748657 3300002501 Bacteria 23805
89 JGI24703J35330_11748689 3300002501 Bacteria 25214
90 JGI24705J35276_12047519 3300002504 Bacteria 913
91 Ga0415639_059509 3300038395 Bacteria 1713
92 Ga0415639_191872 3300038395 Bacteria 1525
93 Ga0466693_306435 3300042592 Bacteria 1361
94 Ga0466715_106974 3300042616 Bacteria 49625
95 Ga0123355_10004772 3300009826 Bacteria 19729
96 Ga0123355_10025638 3300009826 Bacteria 9495
97 Ga0123355_10138776 3300009826 Bacteria 3727
98 Ga0123353_10205636 3300010167 Bacteria 3093
99 Ga0123353_10356565 3300010167 Bacteria 2200
100 Ga0123354_10480087 3300010882 Bacteria 984
101 Ga0466701_085923 3300042598 Bacteria 4992
102 Ga0466706_096117 3300042599 Bacteria 1425
103 Ga0466706_148611 3300042599 Bacteria 1262
104 Ga0466707_052954 3300042601 Bacteria 5283
105 Ga0466714_060419 3300042603 Bacteria 2914
106 Ga0466724_42417 3300042649 Bacteria 1348
107 IMNBL1DRAFT_c0011117 3300000062 Bacteria 4233
108 IMNBL1DRAFT_c0043760 3300000062 Bacteria 1478
109 JGI24695J34938_10000862 3300002450 Bacteria 28085
110 Ga0466693_144858 3300042592 Bacteria 4211
111 Ga0466693_308039 3300042592 Bacteria 3424
112 Ga0466701_002032 3300042598 Bacteria 4181
113 Ga0466733_190799 3300042659 Bacteria 1142
114 Ga0123355_10129263 3300009826 Bacteria 3896
115 Ga0123355_10132122 3300009826 Bacteria 3844
116 Ga0123355_10652475 3300009826 Bacteria 1227
117 Ga0123356_10122485 3300010049 Bacteria 2533
118 Ga0123356_10317437 3300010049 Bacteria 1670
119 Ga0123356_10738034 3300010049 Bacteria 1155
120 Ga0123356_10848425 3300010049 Bacteria 1085
121 Ga0123353_10006354 3300010167 Bacteria 15721
122 Ga0123353_10044987 3300010167 Bacteria 7002
123 Ga0123353_10098392 3300010167 Bacteria 4715
124 Ga0123354_10460245 3300010882 Bacteria 1022
125 Ga0466701_032440 3300042598 Bacteria 36525
126 Ga0466707_285322 3300042601 Bacteria 1079
127 Ga0466717_284405 3300042604 Bacteria 2942
128 JGI24699J35502_11134212 3300002509 Bacteria 62331
129 Ga0072941_1050615 3300005201 Bacteria 12036
130 Ga0415639_100290 3300038395 Bacteria 4817
131 Ga0415639_121935 3300038395 Bacteria 1991
132 Ga0415639_200562 3300038395 Bacteria 1028

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12804 NTP_transf_3 MobA-like NTP transferase domain 3 62 0.88
PF00483 NTP_transferase Nucleotidyl transferase 2 267 0.81

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00483 GO:0009058 biosynthetic process BP

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.