Protein Family IF04791
Metagenome
Isolate
142
Members
61
Samples
123
Scaffolds
366.56
Avg Length
Representative Sequence
- ID
- 3300042592|Ga0466693_278666|Ga0466693_278666_56_1231
- Length
- 391 aa
- Sequence
- MAGASPRRAKKGTPCFTIAIKKQIEVANMKYDYLIVGAGLFGTVFAHEAVRRGKTCLVADKREHIGGNVYTAEIGGIQVHKYGAHIFHTNDKEVWEYVNRFAEFNRFTNAPVANYLGEIFNLPFNMNTFYKLWGVSCPQEALRIIEGQRLKTAEPKNLEEQALSMVGRDIYEKLIKGYTQKQWGRECTELPAFIIKRLPLRFTFDNSYFNDCFQGIPIGGYTQIIEKMLTGCDVRLGTDYFSCRAELDGLAKKTVYTGMTDEYFGFRFGRLEYRSLRFENETLDRENFQGVAVVNYTDAATPYTRIIEHKHFEFGTQPQTVITREYPKEFTQGDEPYYPINDDFNNELYAKYRKLADAEKNVIFGGRLADYKYYDMWQVVRNALDAAVALI
Sample Types
Isolate
13.4%
Metagenome
86.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.0%
Unclassified
21.7%
Kalotermitidae
21.7%
Blattidae
8.3%
Tenebrionidae
6.7%
Termopsidae
5.0%
Apidae
3.3%
Passalidae
3.3%
Vespidae
1.7%
Hodotermitidae
1.7%
Drosophilidae
1.7%
Taxonomy
Archaea
0
Bacteria
140
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 2 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 3 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 7 | 8017458139 | Lactobacillus johnsonii CRL1647 | Isolate | Apidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 12 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 23 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 32 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 33 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 36 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 37 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 38 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 39 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 40 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 41 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 42 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 43 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 44 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 45 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 46 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 48 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 49 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 50 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 51 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 52 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 53 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 54 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 55 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 56 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 57 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 58 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 59 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 60 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 61 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562379_0009 | 3300056790 | Bacteria | 1927879 |
| 2 | Ga0123353_10495186 | 3300010167 | Bacteria | 1783 |
| 3 | Ga0466723_131965 | 3300042618 | Bacteria | 3406 |
| 4 | Ga0466726_341155 | 3300042619 | Bacteria | 2438 |
| 5 | JGI24702J35022_10001584 | 3300002462 | Bacteria | 14114 |
| 6 | JGI24702J35022_10147119 | 3300002462 | Bacteria | 1319 |
| 7 | Ga0466706_198830 | 3300042599 | Bacteria | 1430 |
| 8 | Ga0466713_134616 | 3300042602 | Bacteria | 2878 |
| 9 | Ga0466714_093078 | 3300042603 | Bacteria | 3694 |
| 10 | Ga0466716_461272 | 3300042605 | Bacteria | 7210 |
| 11 | Ga0466705_358599 | 3300042612 | Bacteria | 55295 |
| 12 | Ga0562379_0329 | 3300056790 | Unclassified | 116324 |
| 13 | Ga0562378_1823 | 3300056814 | Unclassified | 20863 |
| 14 | Ga0466708_211570 | 3300042652 | Bacteria | 26487 |
| 15 | Ga0466693_278666 | 3300042592 | Bacteria | 3273 |
| 16 | Ga0466691_046095 | 3300042593 | Bacteria | 4636 |
| 17 | Ga0466696_010174 | 3300042596 | Bacteria | 34499 |
| 18 | Ga0123356_10205237 | 3300010049 | Bacteria | 2014 |
| 19 | Ga0123356_10227989 | 3300010049 | Bacteria | 1925 |
| 20 | Ga0123356_10286629 | 3300010049 | Bacteria | 1745 |
| 21 | Ga0123353_10001649 | 3300010167 | Bacteria | 27459 |
| 22 | Ga0123353_10260499 | 3300010167 | Bacteria | 2679 |
| 23 | Ga0466715_023530 | 3300042616 | Bacteria | 12613 |
| 24 | Ga0466715_376398 | 3300042616 | Bacteria | 1225 |
| 25 | Ga0466723_150183 | 3300042618 | Bacteria | 6384 |
| 26 | Ga0466726_027420 | 3300042619 | Bacteria | 23733 |
| 27 | 2227158569 | 2225789004 | Bacteria | 8420 |
| 28 | JGI24695J34938_10003969 | 3300002450 | Bacteria | 9970 |
| 29 | Ga0068305_10005230 | 3300005083 | Bacteria | 6754 |
| 30 | Ga0466713_039773 | 3300042602 | Bacteria | 12310 |
| 31 | Ga0466719_484742 | 3300042606 | Bacteria | 6099 |
| 32 | Ga0466721_210055 | 3300042608 | Bacteria | 3719 |
| 33 | Ga0562379_0005 | 3300056790 | Bacteria | 2649770 |
| 34 | Ga0562377_0010 | 3300056842 | Bacteria | 1401665 |
| 35 | Ga0466731_381062 | 3300042622 | Bacteria | 4080 |
| 36 | Ga0466735_212598 | 3300042624 | Bacteria | 3791 |
| 37 | Ga0415639_005421 | 3300038395 | Bacteria | 25052 |
| 38 | Ga0466690_322035 | 3300042590 | Bacteria | 3548 |
| 39 | Ga0123353_10107403 | 3300010167 | Bacteria | 4498 |
| 40 | Ga0123353_10164557 | 3300010167 | Bacteria | 3527 |
| 41 | Ga0123353_10284536 | 3300010167 | Bacteria | 2536 |
| 42 | Ga0466705_391319 | 3300042612 | Bacteria | 1831 |
| 43 | Ga0466705_434012 | 3300042612 | Bacteria | 38552 |
| 44 | Ga0466723_086329 | 3300042618 | Bacteria | 6781 |
| 45 | Ga0466706_051926 | 3300042599 | Bacteria | 23911 |
| 46 | Ga0466706_160519 | 3300042599 | Bacteria | 5368 |
| 47 | Ga0466713_140018 | 3300042602 | Bacteria | 29586 |
| 48 | Ga0466716_543822 | 3300042605 | Bacteria | 1612 |
| 49 | Ga0562379_0011 | 3300056790 | Bacteria | 1623141 |
| 50 | Ga0562375_0012 | 3300056856 | Bacteria | 1240899 |
| 51 | Ga0466708_091330 | 3300042652 | Bacteria | 7322 |
| 52 | Ga0466708_321892 | 3300042652 | Bacteria | 7928 |
| 53 | Ga0466727_215100 | 3300042655 | Bacteria | 4081 |
| 54 | Ga0123357_10267663 | 3300009784 | Bacteria | 1793 |
| 55 | Ga0123353_10373983 | 3300010167 | Bacteria | 2135 |
| 56 | Ga0123353_10524018 | 3300010167 | Bacteria | 1719 |
| 57 | Ga0466705_518747 | 3300042612 | Bacteria | 9648 |
| 58 | Ga0466711_286486 | 3300042615 | Bacteria | 8162 |
| 59 | Ga0466728_192504 | 3300042620 | Bacteria | 13798 |
| 60 | JGI24695J34938_10000874 | 3300002450 | Bacteria | 27863 |
| 61 | Ga0466701_094818 | 3300042598 | Bacteria | 4949 |
| 62 | Ga0466706_052481 | 3300042599 | Bacteria | 20425 |
| 63 | Ga0466707_044763 | 3300042601 | Bacteria | 2374 |
| 64 | Ga0466714_043750 | 3300042603 | Bacteria | 4923 |
| 65 | Ga0466703_425813 | 3300042636 | Bacteria | 5486 |
| 66 | Ga0466704_069430 | 3300042643 | Bacteria | 4358 |
| 67 | Ga0466708_417930 | 3300042652 | Bacteria | 20575 |
| 68 | Ga0466691_148224 | 3300042593 | Bacteria | 9593 |
| 69 | Ga0466691_220365 | 3300042593 | Bacteria | 11607 |
| 70 | Ga0123355_10089382 | 3300009826 | Bacteria | 4889 |
| 71 | Ga0466712_004801 | 3300042614 | Bacteria | 20548 |
| 72 | Ga0466711_109385 | 3300042615 | Bacteria | 2873 |
| 73 | Ga0466715_045335 | 3300042616 | Bacteria | 32249 |
| 74 | Ga0466723_347886 | 3300042618 | Bacteria | 4748 |
| 75 | Ga0466726_449069 | 3300042619 | Bacteria | 3135 |
| 76 | JGI24695J34938_10000715 | 3300002450 | Bacteria | 31289 |
| 77 | JGI24702J35022_10031911 | 3300002462 | Bacteria | 2821 |
| 78 | Ga0068305_10027785 | 3300005083 | Bacteria | 5325 |
| 79 | Ga0074188_1000238 | 3300005318 | Bacteria | 16620 |
| 80 | Ga0466706_062227 | 3300042599 | Bacteria | 2959 |
| 81 | Ga0466706_205550 | 3300042599 | Bacteria | 8901 |
| 82 | Ga0466707_233067 | 3300042601 | Bacteria | 1556 |
| 83 | Ga0466707_336274 | 3300042601 | Bacteria | 8742 |
| 84 | Ga0466703_001811 | 3300042636 | Bacteria | 3694 |
| 85 | Ga0466703_177436 | 3300042636 | Bacteria | 6065 |
| 86 | Ga0466708_229225 | 3300042652 | Bacteria | 6590 |
| 87 | Ga0123356_10114857 | 3300010049 | Bacteria | 2608 |
| 88 | Ga0123356_10139472 | 3300010049 | Bacteria | 2390 |
| 89 | Ga0123356_10145035 | 3300010049 | Bacteria | 2348 |
| 90 | Ga0123356_10207739 | 3300010049 | Bacteria | 2003 |
| 91 | Ga0072940_1455191 | 3300005200 | Bacteria | 5863 |
| 92 | Ga0466707_394085 | 3300042601 | Bacteria | 3291 |
| 93 | Ga0466705_310573 | 3300042612 | Bacteria | 8383 |
| 94 | Ga0562379_0346 | 3300056790 | Bacteria | 111489 |
| 95 | Ga0466703_000993 | 3300042636 | Bacteria | 1894 |
| 96 | Ga0466703_172414 | 3300042636 | Bacteria | 2230 |
| 97 | Ga0415639_003875 | 3300038395 | Bacteria | 31877 |
| 98 | Ga0415639_019554 | 3300038395 | Bacteria | 12574 |
| 99 | Ga0466691_148361 | 3300042593 | Bacteria | 7603 |
| 100 | Ga0123356_10009427 | 3300010049 | Bacteria | 9634 |
| 101 | Ga0123356_10141716 | 3300010049 | Bacteria | 2372 |
| 102 | Ga0466715_279443 | 3300042616 | Bacteria | 33719 |
| 103 | Ga0466723_036342 | 3300042618 | Bacteria | 2155 |
| 104 | IMNBL1DRAFT_c0000002 | 3300000062 | Bacteria | 288751 |
| 105 | Ga0466706_185672 | 3300042599 | Bacteria | 9871 |
| 106 | Ga0466714_060377 | 3300042603 | Bacteria | 3056 |
| 107 | Ga0466714_060675 | 3300042603 | Bacteria | 1501 |
| 108 | Ga0466714_075322 | 3300042603 | Bacteria | 12504 |
| 109 | Ga0466717_028783 | 3300042604 | Bacteria | 3648 |
| 110 | Ga0466704_161605 | 3300042643 | Bacteria | 72612 |
| 111 | Ga0415639_005382 | 3300038395 | Bacteria | 48683 |
| 112 | Ga0415639_257920 | 3300038395 | Bacteria | 1939 |
| 113 | Ga0466690_034706 | 3300042590 | Bacteria | 31208 |
| 114 | Ga0123356_10067622 | 3300010049 | Bacteria | 3346 |
| 115 | Ga0123356_10142904 | 3300010049 | Bacteria | 2363 |
| 116 | Ga0123353_10473645 | 3300010167 | Bacteria | 1835 |
| 117 | Ga0072940_1396685 | 3300005200 | Bacteria | 1408 |
| 118 | Ga0466706_046636 | 3300042599 | Bacteria | 5178 |
| 119 | Ga0466706_088277 | 3300042599 | Bacteria | 16625 |
| 120 | Ga0466706_172146 | 3300042599 | Bacteria | 27803 |
| 121 | Ga0466714_012619 | 3300042603 | Bacteria | 11318 |
| 122 | Ga0466714_107226 | 3300042603 | Bacteria | 8008 |
| 123 | Ga0466716_468189 | 3300042605 | Bacteria | 5809 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03275 | GO:0008767 | UDP-galactopyranose mutase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.