Protein Family IF04717
Metagenome
Isolate
130
Members
68
Samples
99
Scaffolds
192.74
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_171932|Ga0466692_171932_104712_105377
- Length
- 221 aa
- Sequence
- MRCLLTGRGANGKNVCAKADFLPALAPMNREPQRCPWPHDELYKKYHDEEWGVPCHDNRHLFEMLILEGAQAGLSWYTVLKKRERYREVFDEFDAEKIARYDARKVTRLLADPGIIRNRLKIAAAIRNAKVYLTVSEEFGSFDRYIWQFIGGKPRQNHWNKPGQVPAKTAESDAMSKDLSKRGFKFVGSTICYAYMQATGMVNDHFTDCFRYKQVRRLGQA
Sample Types
Isolate
23.9%
Metagenome
76.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
23.5%
Unclassified
20.6%
Termitidae
20.6%
Kalotermitidae
20.6%
Rhinotermitidae
4.4%
Passalidae
2.9%
Termopsidae
2.9%
Blattidae
1.5%
Halictidae
1.5%
Drosophilidae
1.5%
Taxonomy
Archaea
3
Bacteria
121
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 2 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 3 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 4 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 5 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 6 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 7 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 8 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 9 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 10 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 11 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 12 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 22 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 23 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 28 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 33 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 34 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 35 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 39 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 40 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 41 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 44 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 45 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 46 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 47 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 48 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 49 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 50 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 51 | 2820539610 | Unclassified Firmicutes Lab288P1bin136 | Isolate | Unclassified |
| 52 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 53 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 54 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 55 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 56 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 57 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 58 | 2820039837 | Unclassified Saccharibacteria Emb289P1bin99 | Isolate | Unclassified |
| 59 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 60 | 2986970932 | Candidatus Fukatsuia symbiotica 5D | Isolate | Unclassified |
| 61 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 62 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 63 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 64 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 65 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 66 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 67 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 68 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_005975 | 3300042612 | Bacteria | 1687 |
| 2 | Ga0466705_036604 | 3300042612 | Bacteria | 4312 |
| 3 | Ga0466705_115095 | 3300042612 | Bacteria | 2795 |
| 4 | Ga0123355_10001244 | 3300009826 | Bacteria | 35535 |
| 5 | Ga0123355_10012430 | 3300009826 | Bacteria | 13181 |
| 6 | Ga0123355_10014126 | 3300009826 | Bacteria | 12462 |
| 7 | Ga0123355_10092081 | 3300009826 | Bacteria | 4803 |
| 8 | Ga0123353_10190219 | 3300010167 | Bacteria | 3241 |
| 9 | Ga0123353_11670282 | 3300010167 | Bacteria | 800 |
| 10 | Ga0466690_144521 | 3300042590 | Bacteria | 3488 |
| 11 | Ga0466692_171932 | 3300042591 | Bacteria | 367168 |
| 12 | Ga0466730_103177 | 3300042625 | Bacteria | 4632 |
| 13 | Ga0466703_389574 | 3300042636 | Bacteria | 6301 |
| 14 | Ga0466708_010441 | 3300042652 | Bacteria | 4092 |
| 15 | Ga0466722_215834 | 3300042609 | Bacteria | 1226 |
| 16 | Ga0123355_10076576 | 3300009826 | Bacteria | 5350 |
| 17 | Ga0466657_260894 | 3300042582 | Bacteria | 2703 |
| 18 | Ga0466703_417169 | 3300042636 | Bacteria | 12362 |
| 19 | Ga0466704_465970 | 3300042643 | Unclassified | 7634 |
| 20 | Ga0466716_001740 | 3300042605 | Bacteria | 1225 |
| 21 | Ga0466719_564636 | 3300042606 | Bacteria | 5136 |
| 22 | JGI24695J34938_10184109 | 3300002450 | Bacteria | 865 |
| 23 | Ga0466723_169641 | 3300042618 | Bacteria | 15708 |
| 24 | Ga0123357_10041494 | 3300009784 | Bacteria | 6257 |
| 25 | Ga0123355_10083189 | 3300009826 | Bacteria | 5103 |
| 26 | Ga0123356_10029193 | 3300010049 | Unclassified | 5167 |
| 27 | Ga0466696_261974 | 3300042596 | Bacteria | 1839 |
| 28 | Ga0466703_218204 | 3300042636 | Bacteria | 3144 |
| 29 | Ga0466703_326040 | 3300042636 | Bacteria | 23248 |
| 30 | Ga0466704_319335 | 3300042643 | Bacteria | 5860 |
| 31 | Ga0466724_36248 | 3300042649 | Unclassified | 1282 |
| 32 | Ga0123357_10000453 | 3300009784 | Bacteria | 39621 |
| 33 | Ga0466723_120372 | 3300042618 | Bacteria | 2665 |
| 34 | Ga0466726_143270 | 3300042619 | Bacteria | 3657 |
| 35 | Ga0466728_320210 | 3300042620 | Bacteria | 3670 |
| 36 | Ga0123355_10257216 | 3300009826 | Bacteria | 2448 |
| 37 | Ga0123355_10604796 | 3300009826 | Bacteria | 1299 |
| 38 | Ga0456237_0000691 | 3300041968 | Bacteria | 5167 |
| 39 | Ga0456237_0008155 | 3300041968 | Bacteria | 1595 |
| 40 | Ga0466696_180766 | 3300042596 | Bacteria | 5403 |
| 41 | Ga0466709_217485 | 3300042648 | Bacteria | 12251 |
| 42 | Ga0466719_170258 | 3300042606 | Bacteria | 1840 |
| 43 | IMNBL1DRAFT_c0000587 | 3300000062 | Archaea | 29358 |
| 44 | JGI24700J35501_10930689 | 3300002508 | Bacteria | 18658 |
| 45 | Ga0466715_118360 | 3300042616 | Bacteria | 5345 |
| 46 | Ga0466728_165253 | 3300042620 | Bacteria | 19087 |
| 47 | Ga0466728_286071 | 3300042620 | Bacteria | 1953 |
| 48 | Ga0123355_10023736 | 3300009826 | Bacteria | 9851 |
| 49 | Ga0123355_10102987 | 3300009826 | Bacteria | 4488 |
| 50 | Ga0123355_10816872 | 3300009826 | Bacteria | 1035 |
| 51 | Ga0123353_10224283 | 3300010167 | Bacteria | 2936 |
| 52 | Ga0466692_088748 | 3300042591 | Bacteria | 9576 |
| 53 | Ga0466696_207416 | 3300042596 | Bacteria | 2278 |
| 54 | Ga0466731_024452 | 3300042622 | Bacteria | 1355 |
| 55 | Ga0466722_002967 | 3300042609 | Bacteria | 2167 |
| 56 | 2227358583 | 2225789004 | Archaea | 27842 |
| 57 | IMNBL1DRAFT_c0000404 | 3300000062 | Archaea | 36565 |
| 58 | Ga0072940_1031737 | 3300005200 | Bacteria | 2630 |
| 59 | Ga0466723_373038 | 3300042618 | Bacteria | 4809 |
| 60 | Ga0466726_359327 | 3300042619 | Bacteria | 15666 |
| 61 | Ga0123355_10000479 | 3300009826 | Bacteria | 53101 |
| 62 | Ga0123355_10013217 | 3300009826 | Bacteria | 12835 |
| 63 | Ga0123355_10055359 | 3300009826 | Bacteria | 6423 |
| 64 | Ga0123355_10096745 | 3300009826 | Bacteria | 4662 |
| 65 | Ga0123355_10200681 | 3300009826 | Bacteria | 2915 |
| 66 | Ga0466690_116127 | 3300042590 | Bacteria | 9591 |
| 67 | Ga0466691_195610 | 3300042593 | Bacteria | 14052 |
| 68 | Ga0466691_207573 | 3300042593 | Bacteria | 16426 |
| 69 | Ga0466703_400886 | 3300042636 | Bacteria | 1450 |
| 70 | Ga0466724_66013 | 3300042649 | Unclassified | 1281 |
| 71 | Ga0466708_343096 | 3300042652 | Bacteria | 2614 |
| 72 | HBC_ctgsDRAFT_1066562 | 3300000333 | Bacteria | 863 |
| 73 | JGI24695J34938_10028769 | 3300002450 | Bacteria | 2606 |
| 74 | Ga0466711_101921 | 3300042615 | Bacteria | 26362 |
| 75 | Ga0466726_114641 | 3300042619 | Bacteria | 5367 |
| 76 | Ga0123357_10059607 | 3300009784 | Bacteria | 5121 |
| 77 | Ga0123355_10057181 | 3300009826 | Bacteria | 6313 |
| 78 | Ga0123355_10377712 | 3300009826 | Bacteria | 1850 |
| 79 | Ga0123355_10384740 | 3300009826 | Bacteria | 1824 |
| 80 | Ga0123353_11214066 | 3300010167 | Bacteria | 988 |
| 81 | Ga0123354_10368158 | 3300010882 | Unclassified | 1258 |
| 82 | Ga0466690_400471 | 3300042590 | Bacteria | 2004 |
| 83 | Ga0466708_369416 | 3300042652 | Bacteria | 2202 |
| 84 | Ga0466733_189977 | 3300042659 | Bacteria | 1389 |
| 85 | Ga0466723_030122 | 3300042618 | Bacteria | 1660 |
| 86 | Ga0123357_10423316 | 3300009784 | Bacteria | 1185 |
| 87 | Ga0123355_10000494 | 3300009826 | Bacteria | 52434 |
| 88 | Ga0123355_10003708 | 3300009826 | Bacteria | 22034 |
| 89 | Ga0123355_10046742 | 3300009826 | Bacteria | 7039 |
| 90 | Ga0123355_10344156 | 3300009826 | Bacteria | 1983 |
| 91 | Ga0466696_270017 | 3300042596 | Bacteria | 2982 |
| 92 | Ga0466699_003870 | 3300042597 | Bacteria | 6783 |
| 93 | Ga0466704_112341 | 3300042643 | Bacteria | 3602 |
| 94 | Ga0466704_348393 | 3300042643 | Bacteria | 2826 |
| 95 | Ga0466708_071841 | 3300042652 | Bacteria | 2624 |
| 96 | Ga0466727_311706 | 3300042655 | Bacteria | 2303 |
| 97 | Ga0466719_109805 | 3300042606 | Bacteria | 23560 |
| 98 | Ga0466719_338128 | 3300042606 | Bacteria | 3706 |
| 99 | Ga0074278_139003 | 3300005721 | Unclassified | 4143 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03352 | Adenine_glyco | Methyladenine glycosylase | 39 | 211 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.