Protein Family IF04714
Metagenome
Isolate
242
Members
93
Samples
218
Scaffolds
594.72
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_168759|Ga0466692_168759_3469_5409
- Length
- 646 aa
- Sequence
- MSERGVYQPYRPIEPGVSEGQAQRLIDLRMTGICLRVIRNLFERKMKENKPIDLSAILSAIPESPGVYMHLDENETIIYVGKAKNLKKRVSSYFNKTQDHPKTRMMVRKIRNIRYLVVESEEDAFLLENNLIKEHQPRYNMMLKDDKTYPWIVVKNEPFPRIFLTRRKIDDKSRYYGPYTSALAVRQLLRFLTSLYPIRICNHKLTQENIEKGKFRVCLQYHIKKCLGPCAGRQPEEDYRNSVQVIEEILKGNSKEMSRLLYKNMMRLASEMRFEEAAVLKERYEMLENYSAKSIVASPSLNNVDVFSFDEDKQSAYINYLHIANGAIIRGYTIEYRKQMDETMENILAMGIIELRTRFESRAKEVIVPFLPDVELSGAEWTVPQRGEKKKLLELSEKNVRQYKLDQLKQAEKLNPEQRTTRILKTLQDDLHLKELPVHIECFDNSNIQGTHPVSACVVFKKARPSKKDYRHFNIKTVVGPDDFGSMYETVFRRYKRLSEEEQPLPQLLVIDGGKGQLHAAADALKDLGLYGRIPLIGIAKRLEEIYFPTDPVPLYLDKNSESLRLIQQLRDEAHRFGITFHRKKRSRQQIASELDAIKGIGPVVKEKLLKKYKSVKKIKEASPAEIVECIGPKKAEALFRGFRPS
Sample Types
Isolate
9.9%
Metagenome
90.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
26.7%
Kalotermitidae
15.6%
Unclassified
15.6%
Blattidae
7.8%
Armadillidiidae
6.7%
Culicidae
5.6%
Rhinotermitidae
4.4%
Termopsidae
4.4%
Formicidae
3.3%
Hydrophilidae
2.2%
Tenebrionidae
2.2%
Drosophilidae
2.2%
Passalidae
2.2%
Daphniidae
1.1%
Taxonomy
Archaea
0
Bacteria
234
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 12 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 13 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 14 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 17 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 27 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 28 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 31 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 32 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 33 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 34 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 35 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 36 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 37 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 38 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 41 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 42 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 43 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 46 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 47 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 48 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 49 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 50 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 51 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 52 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 53 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 54 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 55 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 56 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 57 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 58 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 59 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 60 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 61 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 62 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 63 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 64 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 65 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 66 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 67 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 68 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 69 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 70 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 71 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 72 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 73 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 74 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 75 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 76 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 77 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 78 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 79 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 80 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 81 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 82 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 83 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 84 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 85 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 86 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 87 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 88 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 89 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 90 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 91 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 92 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 93 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_155754 | 3300042659 | Bacteria | 9808 |
| 2 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 3 | Ga0466701_052765 | 3300042598 | Bacteria | 148853 |
| 4 | Ga0466707_136654 | 3300042601 | Bacteria | 15946 |
| 5 | Ga0466707_144321 | 3300042601 | Bacteria | 17726 |
| 6 | Ga0466707_187402 | 3300042601 | Bacteria | 29769 |
| 7 | Ga0466707_221537 | 3300042601 | Bacteria | 3794 |
| 8 | Ga0466713_096507 | 3300042602 | Bacteria | 18345 |
| 9 | Ga0466716_175246 | 3300042605 | Bacteria | 20455 |
| 10 | Ga0466705_043883 | 3300042612 | Bacteria | 44680 |
| 11 | Ga0466703_045010 | 3300042636 | Bacteria | 4958 |
| 12 | Ga0466703_091103 | 3300042636 | Bacteria | 2765 |
| 13 | Ga0466703_158987 | 3300042636 | Bacteria | 11731 |
| 14 | Ga0466703_204119 | 3300042636 | Bacteria | 8700 |
| 15 | Ga0466703_305891 | 3300042636 | Bacteria | 3380 |
| 16 | Ga0466724_28891 | 3300042649 | Bacteria | 455231 |
| 17 | Ga0466711_120138 | 3300042615 | Bacteria | 6212 |
| 18 | Ga0466711_403972 | 3300042615 | Bacteria | 61875 |
| 19 | Ga0466715_076767 | 3300042616 | Bacteria | 23423 |
| 20 | Ga0466715_159345 | 3300042616 | Bacteria | 29954 |
| 21 | Ga0466715_358257 | 3300042616 | Bacteria | 24317 |
| 22 | 2227507947 | 2225789004 | Bacteria | 71292 |
| 23 | IMNBL1DRAFT_c0000785 | 3300000062 | Bacteria | 25114 |
| 24 | JGI24705J35276_12223922 | 3300002504 | Bacteria | 2558 |
| 25 | JGI24705J35276_12238036 | 3300002504 | Bacteria | 15194 |
| 26 | JGI24699J35502_11134056 | 3300002509 | Bacteria | 27277 |
| 27 | Ga0123357_10001340 | 3300009784 | Bacteria | 26023 |
| 28 | Ga0123356_10005286 | 3300010049 | Bacteria | 13177 |
| 29 | Ga0123354_10000186 | 3300010882 | Bacteria | 52457 |
| 30 | Ga0123354_10078104 | 3300010882 | Bacteria | 4708 |
| 31 | Ga0160455_100016 | 3300012837 | Bacteria | 470507 |
| 32 | Ga0160460_100013 | 3300012845 | Bacteria | 460073 |
| 33 | Ga0160433_101849 | 3300012846 | Bacteria | 5147 |
| 34 | Ga0160435_1000114 | 3300012857 | Unclassified | 46673 |
| 35 | Ga0466690_006457 | 3300042590 | Bacteria | 3708 |
| 36 | Ga0466692_073863 | 3300042591 | Bacteria | 38781 |
| 37 | Ga0466693_116857 | 3300042592 | Bacteria | 1991 |
| 38 | Ga0466699_284338 | 3300042597 | Bacteria | 1698 |
| 39 | Ga0466732_277433 | 3300042656 | Bacteria | 43245 |
| 40 | Ga0466733_150639 | 3300042659 | Bacteria | 185699 |
| 41 | Ga0466701_055658 | 3300042598 | Bacteria | 38151 |
| 42 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 43 | Ga0466714_084657 | 3300042603 | Bacteria | 3504 |
| 44 | Ga0466697_096879 | 3300042611 | Bacteria | 330838 |
| 45 | Ga0466697_113220 | 3300042611 | Bacteria | 2180 |
| 46 | Ga0466705_056487 | 3300042612 | Bacteria | 11616 |
| 47 | Ga0466705_325670 | 3300042612 | Bacteria | 11515 |
| 48 | Ga0466729_215003 | 3300042621 | Bacteria | 1929 |
| 49 | Ga0466735_128327 | 3300042624 | Bacteria | 3173 |
| 50 | Ga0466704_460153 | 3300042643 | Bacteria | 10237 |
| 51 | Ga0466724_02195 | 3300042649 | Bacteria | 8328 |
| 52 | Ga0466727_261708 | 3300042655 | Bacteria | 3733 |
| 53 | Ga0466723_051232 | 3300042618 | Bacteria | 14582 |
| 54 | Ga0466726_234425 | 3300042619 | Bacteria | 6071 |
| 55 | IMNBL1DRAFT_c0002721 | 3300000062 | Bacteria | 12041 |
| 56 | IMNBL1DRAFT_c0010343 | 3300000062 | Bacteria | 4483 |
| 57 | JGI24702J35022_10003984 | 3300002462 | Bacteria | 8862 |
| 58 | JGI24702J35022_10043892 | 3300002462 | Bacteria | 2382 |
| 59 | JGI24699J35502_11133640 | 3300002509 | Bacteria | 12852 |
| 60 | JGI24699J35502_11134138 | 3300002509 | Bacteria | 36202 |
| 61 | Ga0068302_10101704 | 3300005071 | Bacteria | 4872 |
| 62 | Ga0068305_10182627 | 3300005083 | Unclassified | 5839 |
| 63 | Ga0123357_10001874 | 3300009784 | Bacteria | 22834 |
| 64 | Ga0123353_10074106 | 3300010167 | Bacteria | 5472 |
| 65 | Ga0160465_100010 | 3300012803 | Bacteria | 359268 |
| 66 | Ga0160465_100020 | 3300012803 | Bacteria | 253724 |
| 67 | Ga0466690_018936 | 3300042590 | Bacteria | 8628 |
| 68 | Ga0466690_090432 | 3300042590 | Bacteria | 9970 |
| 69 | Ga0466691_018749 | 3300042593 | Bacteria | 6098 |
| 70 | Ga0466696_225169 | 3300042596 | Bacteria | 26389 |
| 71 | Ga0466700_075647 | 3300042600 | Bacteria | 4018 |
| 72 | Ga0466729_275172 | 3300042621 | Bacteria | 3577 |
| 73 | Ga0466703_165518 | 3300042636 | Bacteria | 3579 |
| 74 | Ga0466709_014514 | 3300042648 | Bacteria | 492815 |
| 75 | Ga0466727_316709 | 3300042655 | Bacteria | 34486 |
| 76 | Ga0466723_170348 | 3300042618 | Bacteria | 25045 |
| 77 | Ga0466726_076133 | 3300042619 | Bacteria | 50177 |
| 78 | Ga0466726_179462 | 3300042619 | Bacteria | 13389 |
| 79 | Ga0466729_007879 | 3300042621 | Bacteria | 30241 |
| 80 | IMNBL1DRAFT_c0003440 | 3300000062 | Bacteria | 10186 |
| 81 | JGI24702J35022_10020945 | 3300002462 | Bacteria | 3549 |
| 82 | Ga0123357_10043666 | 3300009784 | Bacteria | 6090 |
| 83 | Ga0123353_10024007 | 3300010167 | Bacteria | 9245 |
| 84 | Ga0123353_10344938 | 3300010167 | Bacteria | 2247 |
| 85 | Ga0123353_10373409 | 3300010167 | Bacteria | 2137 |
| 86 | Ga0160469_102320 | 3300012824 | Unclassified | 3665 |
| 87 | Ga0160441_101413 | 3300012825 | Bacteria | 7517 |
| 88 | Ga0160472_100805 | 3300012839 | Bacteria | 13211 |
| 89 | Ga0160434_100093 | 3300012850 | Unclassified | 53667 |
| 90 | Ga0160457_1000618 | 3300012858 | Bacteria | 14156 |
| 91 | Ga0466690_253941 | 3300042590 | Bacteria | 20390 |
| 92 | Ga0466692_029952 | 3300042591 | Bacteria | 12294 |
| 93 | Ga0466696_307874 | 3300042596 | Bacteria | 11381 |
| 94 | Ga0466733_090983 | 3300042659 | Bacteria | 8051 |
| 95 | Ga0466701_078688 | 3300042598 | Bacteria | 69881 |
| 96 | Ga0466716_105623 | 3300042605 | Bacteria | 7048 |
| 97 | Ga0466719_467287 | 3300042606 | Bacteria | 5727 |
| 98 | Ga0466722_029449 | 3300042609 | Bacteria | 5785 |
| 99 | Ga0466734_149994 | 3300042623 | Bacteria | 4128 |
| 100 | Ga0466735_031351 | 3300042624 | Bacteria | 11211 |
| 101 | Ga0466703_039792 | 3300042636 | Bacteria | 28795 |
| 102 | Ga0466703_144705 | 3300042636 | Bacteria | 15009 |
| 103 | Ga0466704_330242 | 3300042643 | Bacteria | 11401 |
| 104 | Ga0466709_112853 | 3300042648 | Bacteria | 6092 |
| 105 | Ga0466708_243982 | 3300042652 | Bacteria | 25514 |
| 106 | Ga0466727_144932 | 3300042655 | Bacteria | 27909 |
| 107 | 2227514102 | 2225789004 | Bacteria | 3487 |
| 108 | JGI24702J35022_10003166 | 3300002462 | Bacteria | 9954 |
| 109 | JGI24702J35022_10005147 | 3300002462 | Bacteria | 7671 |
| 110 | JGI24702J35022_10007219 | 3300002462 | Bacteria | 6385 |
| 111 | JGI24702J35022_10031347 | 3300002462 | Bacteria | 2849 |
| 112 | CVPL010W_10002027 | 3300002931 | Bacteria | 23856 |
| 113 | Ga0104048_1001791 | 3300007143 | Bacteria | 4377 |
| 114 | Ga0123357_10012451 | 3300009784 | Bacteria | 10978 |
| 115 | Ga0123353_10001040 | 3300010167 | Bacteria | 34017 |
| 116 | Ga0123353_10010525 | 3300010167 | Bacteria | 12902 |
| 117 | Ga0123354_10039269 | 3300010882 | Bacteria | 7340 |
| 118 | Ga0160433_100435 | 3300012846 | Unclassified | 21612 |
| 119 | Ga0466690_183666 | 3300042590 | Bacteria | 8816 |
| 120 | Ga0466701_021511 | 3300042598 | Bacteria | 8152 |
| 121 | Ga0466700_119831 | 3300042600 | Bacteria | 20318 |
| 122 | Ga0466700_282668 | 3300042600 | Bacteria | 5041 |
| 123 | Ga0466713_007433 | 3300042602 | Bacteria | 8152 |
| 124 | Ga0466713_124887 | 3300042602 | Bacteria | 13976 |
| 125 | Ga0466713_156423 | 3300042602 | Bacteria | 30043 |
| 126 | Ga0466714_066823 | 3300042603 | Bacteria | 4020 |
| 127 | Ga0466722_227168 | 3300042609 | Bacteria | 3234 |
| 128 | Ga0466735_055931 | 3300042624 | Bacteria | 6840 |
| 129 | Ga0466708_283752 | 3300042652 | Bacteria | 2678 |
| 130 | Ga0466727_045994 | 3300042655 | Bacteria | 9519 |
| 131 | 2227477413 | 2225789004 | Unclassified | 22366 |
| 132 | Ga0123357_10000085 | 3300009784 | Bacteria | 75372 |
| 133 | Ga0123356_10020734 | 3300010049 | Bacteria | 6216 |
| 134 | Ga0160455_100105 | 3300012837 | Bacteria | 123596 |
| 135 | Ga0160445_100249 | 3300012847 | Bacteria | 38513 |
| 136 | Ga0466657_210485 | 3300042582 | Bacteria | 22461 |
| 137 | Ga0466733_028910 | 3300042659 | Bacteria | 2573 |
| 138 | Ga0466716_273156 | 3300042605 | Bacteria | 2347 |
| 139 | Ga0466716_496543 | 3300042605 | Bacteria | 6762 |
| 140 | Ga0466721_020669 | 3300042608 | Bacteria | 22937 |
| 141 | Ga0466730_054806 | 3300042625 | Bacteria | 801523 |
| 142 | Ga0466704_053113 | 3300042643 | Bacteria | 15533 |
| 143 | Ga0466704_577848 | 3300042643 | Bacteria | 5648 |
| 144 | Ga0466710_174404 | 3300042613 | Bacteria | 6957 |
| 145 | Ga0466710_392961 | 3300042613 | Bacteria | 3606 |
| 146 | Ga0466710_423219 | 3300042613 | Bacteria | 1956 |
| 147 | Ga0466711_070021 | 3300042615 | Bacteria | 21814 |
| 148 | Ga0466715_093814 | 3300042616 | Bacteria | 11617 |
| 149 | Ga0466723_123771 | 3300042618 | Bacteria | 12843 |
| 150 | Ga0102740_1000415 | 3300007140 | Bacteria | 11868 |
| 151 | Ga0104048_1003424 | 3300007143 | Bacteria | 6661 |
| 152 | Ga0123357_10001884 | 3300009784 | Bacteria | 22787 |
| 153 | Ga0160469_100013 | 3300012824 | Bacteria | 444998 |
| 154 | Ga0160433_100012 | 3300012846 | Bacteria | 265415 |
| 155 | Ga0160445_100591 | 3300012847 | Unclassified | 15909 |
| 156 | Ga0466690_322261 | 3300042590 | Bacteria | 21248 |
| 157 | Ga0466690_378263 | 3300042590 | Bacteria | 22561 |
| 158 | Ga0466692_168038 | 3300042591 | Bacteria | 2784 |
| 159 | Ga0466692_168759 | 3300042591 | Bacteria | 5576 |
| 160 | Ga0466691_095154 | 3300042593 | Bacteria | 7390 |
| 161 | Ga0466696_486478 | 3300042596 | Bacteria | 1815 |
| 162 | Ga0466701_000462 | 3300042598 | Bacteria | 39838 |
| 163 | Ga0466701_094285 | 3300042598 | Unclassified | 4559 |
| 164 | Ga0466713_000880 | 3300042602 | Bacteria | 20825 |
| 165 | Ga0466713_143771 | 3300042602 | Bacteria | 14894 |
| 166 | Ga0466719_326107 | 3300042606 | Bacteria | 2727 |
| 167 | Ga0466719_567749 | 3300042606 | Bacteria | 5679 |
| 168 | Ga0466729_208225 | 3300042621 | Bacteria | 6570 |
| 169 | Ga0466729_223968 | 3300042621 | Bacteria | 5984 |
| 170 | Ga0466735_186532 | 3300042624 | Bacteria | 3048 |
| 171 | Ga0466735_194728 | 3300042624 | Bacteria | 5144 |
| 172 | Ga0466703_135121 | 3300042636 | Bacteria | 3733 |
| 173 | Ga0466704_307788 | 3300042643 | Bacteria | 15366 |
| 174 | Ga0466709_233448 | 3300042648 | Bacteria | 27682 |
| 175 | Ga0466711_032287 | 3300042615 | Bacteria | 10941 |
| 176 | Ga0466715_368883 | 3300042616 | Bacteria | 6573 |
| 177 | Ga0466723_023375 | 3300042618 | Bacteria | 9981 |
| 178 | Ga0466726_428257 | 3300042619 | Bacteria | 2063 |
| 179 | Ga0466726_436531 | 3300042619 | Bacteria | 3715 |
| 180 | Ga0466728_430369 | 3300042620 | Bacteria | 8443 |
| 181 | Ga0104045_1005542 | 3300007085 | Bacteria | 8024 |
| 182 | Ga0123357_10000678 | 3300009784 | Bacteria | 34027 |
| 183 | Ga0123357_10032404 | 3300009784 | Bacteria | 7098 |
| 184 | Ga0123357_10037303 | 3300009784 | Bacteria | 6615 |
| 185 | Ga0123357_10248477 | 3300009784 | Bacteria | 1909 |
| 186 | Ga0123353_10103210 | 3300010167 | Bacteria | 4596 |
| 187 | Ga0160458_100109 | 3300012832 | Bacteria | 83580 |
| 188 | Ga0466691_005260 | 3300042593 | Bacteria | 8051 |
| 189 | Ga0466691_031423 | 3300042593 | Bacteria | 2130 |
| 190 | Ga0466696_049113 | 3300042596 | Bacteria | 63300 |
| 191 | Ga0466707_072525 | 3300042601 | Bacteria | 13511 |
| 192 | Ga0466707_208026 | 3300042601 | Bacteria | 3215 |
| 193 | Ga0466713_095735 | 3300042602 | Bacteria | 6510 |
| 194 | Ga0466697_271821 | 3300042611 | Bacteria | 3645 |
| 195 | Ga0466709_214621 | 3300042648 | Bacteria | 11712 |
| 196 | Ga0466708_053168 | 3300042652 | Bacteria | 12127 |
| 197 | Ga0466727_042186 | 3300042655 | Bacteria | 4400 |
| 198 | Ga0466711_244271 | 3300042615 | Bacteria | 4718 |
| 199 | Ga0466715_244849 | 3300042616 | Bacteria | 30324 |
| 200 | Ga0466715_423803 | 3300042616 | Bacteria | 5939 |
| 201 | Ga0466718_159032 | 3300042617 | Bacteria | 1877 |
| 202 | 2227481315 | 2225789004 | Bacteria | 4425 |
| 203 | 2227502988 | 2225789004 | Bacteria | 3750 |
| 204 | Ga0068305_10234432 | 3300005083 | Bacteria | 4781 |
| 205 | Ga0102734_1001163 | 3300007129 | Bacteria | 6695 |
| 206 | Ga0123357_10018649 | 3300009784 | Bacteria | 9230 |
| 207 | Ga0123357_10094610 | 3300009784 | Bacteria | 3877 |
| 208 | Ga0123355_10016100 | 3300009826 | Bacteria | 11773 |
| 209 | Ga0123355_10018617 | 3300009826 | Bacteria | 11028 |
| 210 | Ga0123353_10000028 | 3300010167 | Bacteria | 164820 |
| 211 | Ga0123354_10000609 | 3300010882 | Bacteria | 37298 |
| 212 | Ga0160443_100023 | 3300012848 | Bacteria | 403656 |
| 213 | Ga0160430_100721 | 3300012852 | Bacteria | 15975 |
| 214 | Ga0466657_025152 | 3300042582 | Bacteria | 4495 |
| 215 | Ga0466692_165865 | 3300042591 | Bacteria | 23835 |
| 216 | Ga0466691_189588 | 3300042593 | Bacteria | 38196 |
| 217 | Ga0466695_285341 | 3300042595 | Bacteria | 15370 |
| 218 | Ga0466696_057309 | 3300042596 | Bacteria | 8007 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF08459 | GO:0009381 | excinuclease ABC activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.