Protein Family IF04710
Metagenome
Isolate
184
Members
90
Samples
149
Scaffolds
387.91
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_165042|Ga0466692_165042_609_1868
- Length
- 419 aa
- Sequence
- MNKMNNNHSTVIAKAEPEAIRRKQYEIHLMNKVQVLYAGCLLLVAMNMAAQEEKSSLNPIYTGVPSLTIAPDARGGSMGDVGVATSPDMVSQYWNPAKLPFAWSKAGVQLSYTPWLRKLVSDIDLAYLSGYYKIGSEDNQAVGASIRYFSLGEVHLQETVDDIGMNINPYEMALDVSYSVKLTENFAGAVAFRYIRSDLGAGVVAGTDVGNAYAADVAGYYNKYVVAGSNECLLGLGFNISNIGTKISYNGGSISHFLPTNLRLGASYLMPLDDYNTLSLSLDLNKYLVPTPPDTRDIEDQVEKQRIEDEYKSISPITGIFKSFGDAPGGMKEELQEIMWSAGAEYAYNNQFFVRGGYFYEHPNKGNRQYFSLGAGFRMNVLQLDVAYLVATAASNPLDQTLRFSLTFDMDGLKGLLNR
Sample Types
Isolate
19.0%
Metagenome
81.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
26.7%
Termitidae
16.7%
Kalotermitidae
15.6%
Unclassified
10.0%
Formicidae
7.8%
Rhinotermitidae
5.6%
Drosophilidae
3.3%
Termopsidae
3.3%
Passalidae
3.3%
Hydrophilidae
2.2%
Armadillidiidae
2.2%
Hodotermitidae
1.1%
Apidae
1.1%
Tenebrionidae
1.1%
Taxonomy
Archaea
0
Bacteria
179
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 2 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 3 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 4 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 5 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 6 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 7 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 8 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 9 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 15 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 20 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 21 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 22 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 23 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 31 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 32 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 33 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 34 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 41 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 42 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 43 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 44 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 45 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 46 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 47 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 48 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 49 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 50 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 51 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 52 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 53 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 54 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 55 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 56 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 57 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 58 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 59 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 60 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 61 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 62 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 63 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 64 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 65 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 66 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 67 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 68 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 69 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 70 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 71 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 72 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 73 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 74 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 75 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 76 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 77 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 78 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 79 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 80 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 81 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 82 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 83 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 84 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 85 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 86 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 87 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 88 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 89 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 90 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_055799 | 3300042659 | Bacteria | 106016 |
| 2 | IMNBL1DRAFT_c0001009 | 3300000062 | Bacteria | 21721 |
| 3 | JGI24702J35022_10000743 | 3300002462 | Bacteria | 20084 |
| 4 | JGI24702J35022_10069910 | 3300002462 | Bacteria | 1889 |
| 5 | JGI24699J35502_11134185 | 3300002509 | Bacteria | 47737 |
| 6 | Ga0104045_1003639 | 3300007085 | Bacteria | 1920 |
| 7 | Ga0104050_1026167 | 3300007153 | Bacteria | 6347 |
| 8 | Ga0466715_161968 | 3300042616 | Bacteria | 8358 |
| 9 | Ga0466706_074360 | 3300042599 | Bacteria | 8175 |
| 10 | Ga0466706_160405 | 3300042599 | Bacteria | 9242 |
| 11 | Ga0466707_065166 | 3300042601 | Bacteria | 2502 |
| 12 | Ga0466722_005250 | 3300042609 | Bacteria | 14032 |
| 13 | Ga0466722_196515 | 3300042609 | Bacteria | 1836 |
| 14 | Ga0466697_011496 | 3300042611 | Bacteria | 51969 |
| 15 | Ga0466690_211147 | 3300042590 | Bacteria | 29487 |
| 16 | Ga0466696_097884 | 3300042596 | Bacteria | 16155 |
| 17 | Ga0466735_114704 | 3300042624 | Bacteria | 2421 |
| 18 | Ga0466704_055817 | 3300042643 | Bacteria | 8022 |
| 19 | Ga0466704_251609 | 3300042643 | Bacteria | 45182 |
| 20 | Ga0466727_318309 | 3300042655 | Bacteria | 3857 |
| 21 | Ga0123353_10288115 | 3300010167 | Bacteria | 2516 |
| 22 | 2227008130 | 2225789003 | Bacteria | 29189 |
| 23 | 2227582948 | 2225789004 | Bacteria | 13326 |
| 24 | IMNBL1DRAFT_c0001178 | 3300000062 | Bacteria | 19919 |
| 25 | Ga0123357_10000910 | 3300009784 | Bacteria | 30052 |
| 26 | Ga0466705_399227 | 3300042612 | Bacteria | 3810 |
| 27 | Ga0466728_229381 | 3300042620 | Bacteria | 18640 |
| 28 | Ga0466701_017057 | 3300042598 | Bacteria | 176601 |
| 29 | Ga0466713_056151 | 3300042602 | Bacteria | 40882 |
| 30 | Ga0466713_116696 | 3300042602 | Bacteria | 4828 |
| 31 | Ga0466722_087839 | 3300042609 | Bacteria | 11186 |
| 32 | Ga0466722_092954 | 3300042609 | Bacteria | 48543 |
| 33 | Ga0466656_378056 | 3300042550 | Bacteria | 2564 |
| 34 | Ga0466696_049250 | 3300042596 | Bacteria | 2670 |
| 35 | Ga0466735_059852 | 3300042624 | Bacteria | 8124 |
| 36 | Ga0466703_165459 | 3300042636 | Bacteria | 12745 |
| 37 | Ga0466704_297287 | 3300042643 | Bacteria | 3007 |
| 38 | Ga0466709_138735 | 3300042648 | Bacteria | 8245 |
| 39 | 2227327997 | 2225789004 | Bacteria | 6360 |
| 40 | JGI24702J35022_10010203 | 3300002462 | Bacteria | 5259 |
| 41 | JGI24702J35022_10033381 | 3300002462 | Bacteria | 2753 |
| 42 | JGI24699J35502_11133779 | 3300002509 | Bacteria | 15459 |
| 43 | CVPL010W_10007653 | 3300002931 | Bacteria | 10527 |
| 44 | Ga0466711_171358 | 3300042615 | Bacteria | 5581 |
| 45 | Ga0466715_583205 | 3300042616 | Bacteria | 24186 |
| 46 | Ga0466728_300361 | 3300042620 | Bacteria | 29412 |
| 47 | Ga0466706_059455 | 3300042599 | Bacteria | 7609 |
| 48 | Ga0466713_059975 | 3300042602 | Bacteria | 22865 |
| 49 | Ga0466690_246577 | 3300042590 | Bacteria | 16883 |
| 50 | Ga0466691_148747 | 3300042593 | Bacteria | 15449 |
| 51 | Ga0466695_080367 | 3300042595 | Bacteria | 3025 |
| 52 | Ga0466703_202703 | 3300042636 | Bacteria | 8925 |
| 53 | Ga0466704_494803 | 3300042643 | Bacteria | 2830 |
| 54 | Ga0123354_10114610 | 3300010882 | Bacteria | 3529 |
| 55 | Ga0466705_233444 | 3300042612 | Bacteria | 9951 |
| 56 | Ga0104048_1170946 | 3300007143 | Bacteria | 1578 |
| 57 | Ga0466710_292942 | 3300042613 | Bacteria | 2526 |
| 58 | Ga0466710_337619 | 3300042613 | Bacteria | 6084 |
| 59 | Ga0466711_072455 | 3300042615 | Bacteria | 67585 |
| 60 | Ga0466711_324855 | 3300042615 | Bacteria | 13815 |
| 61 | Ga0466711_371290 | 3300042615 | Bacteria | 10082 |
| 62 | Ga0466726_048125 | 3300042619 | Bacteria | 3369 |
| 63 | Ga0466728_360011 | 3300042620 | Bacteria | 10825 |
| 64 | Ga0466707_161645 | 3300042601 | Bacteria | 28036 |
| 65 | Ga0466713_011019 | 3300042602 | Bacteria | 19476 |
| 66 | Ga0466716_103220 | 3300042605 | Bacteria | 15494 |
| 67 | Ga0466716_216072 | 3300042605 | Bacteria | 7141 |
| 68 | Ga0466719_413201 | 3300042606 | Bacteria | 2918 |
| 69 | Ga0466657_087994 | 3300042582 | Unclassified | 3196 |
| 70 | Ga0466657_136010 | 3300042582 | Bacteria | 11968 |
| 71 | Ga0466690_038698 | 3300042590 | Bacteria | 19777 |
| 72 | Ga0466692_165042 | 3300042591 | Bacteria | 3646 |
| 73 | Ga0466696_157636 | 3300042596 | Bacteria | 2773 |
| 74 | Ga0466735_205875 | 3300042624 | Bacteria | 2596 |
| 75 | Ga0466703_075697 | 3300042636 | Bacteria | 9217 |
| 76 | Ga0466704_125322 | 3300042643 | Bacteria | 12471 |
| 77 | Ga0466709_363785 | 3300042648 | Bacteria | 41688 |
| 78 | Ga0466733_165958 | 3300042659 | Bacteria | 2650 |
| 79 | IMNBL1DRAFT_c0000733 | 3300000062 | Bacteria | 26035 |
| 80 | JGI24705J35276_12238673 | 3300002504 | Bacteria | 35524 |
| 81 | Ga0102735_1000440 | 3300007080 | Bacteria | 8936 |
| 82 | Ga0103268_1000703 | 3300007192 | Unclassified | 9598 |
| 83 | Ga0466715_290868 | 3300042616 | Bacteria | 7967 |
| 84 | Ga0466715_625525 | 3300042616 | Unclassified | 7456 |
| 85 | Ga0466707_016891 | 3300042601 | Bacteria | 35922 |
| 86 | Ga0466719_457528 | 3300042606 | Bacteria | 7994 |
| 87 | Ga0466692_176669 | 3300042591 | Bacteria | 77723 |
| 88 | Ga0466691_122501 | 3300042593 | Bacteria | 7158 |
| 89 | Ga0466691_183257 | 3300042593 | Bacteria | 2125 |
| 90 | Ga0466696_003743 | 3300042596 | Bacteria | 8451 |
| 91 | Ga0466703_064726 | 3300042636 | Bacteria | 3748 |
| 92 | Ga0466703_314103 | 3300042636 | Bacteria | 9653 |
| 93 | Ga0466708_046243 | 3300042652 | Bacteria | 10646 |
| 94 | 2227258581 | 2225789004 | Bacteria | 7027 |
| 95 | IMNBL1DRAFT_c0003460 | 3300000062 | Bacteria | 10134 |
| 96 | JGI24702J35022_10000410 | 3300002462 | Bacteria | 25605 |
| 97 | Ga0068305_10032376 | 3300005083 | Bacteria | 3933 |
| 98 | Ga0466711_273604 | 3300042615 | Bacteria | 21348 |
| 99 | Ga0466715_040385 | 3300042616 | Bacteria | 43736 |
| 100 | Ga0466723_089568 | 3300042618 | Bacteria | 54083 |
| 101 | Ga0466728_188456 | 3300042620 | Bacteria | 11482 |
| 102 | Ga0466728_204044 | 3300042620 | Bacteria | 20525 |
| 103 | Ga0466713_034436 | 3300042602 | Bacteria | 12185 |
| 104 | Ga0466722_055456 | 3300042609 | Bacteria | 2608 |
| 105 | Ga0160455_100143 | 3300012837 | Bacteria | 88256 |
| 106 | Ga0160433_100102 | 3300012846 | Bacteria | 86318 |
| 107 | Ga0466696_054708 | 3300042596 | Bacteria | 19377 |
| 108 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 109 | Ga0103265_1000672 | 3300007068 | Bacteria | 5731 |
| 110 | Ga0102737_1000070 | 3300007142 | Bacteria | 41738 |
| 111 | Ga0466711_201488 | 3300042615 | Bacteria | 18778 |
| 112 | Ga0466711_252475 | 3300042615 | Bacteria | 2845 |
| 113 | Ga0466715_106437 | 3300042616 | Bacteria | 8386 |
| 114 | Ga0466729_190476 | 3300042621 | Bacteria | 6078 |
| 115 | Ga0466707_095132 | 3300042601 | Bacteria | 7364 |
| 116 | Ga0466692_150345 | 3300042591 | Bacteria | 15119 |
| 117 | Ga0466696_265818 | 3300042596 | Bacteria | 2379 |
| 118 | Ga0466729_219568 | 3300042621 | Bacteria | 6131 |
| 119 | Ga0466735_076805 | 3300042624 | Bacteria | 1849 |
| 120 | Ga0466735_211515 | 3300042624 | Bacteria | 3083 |
| 121 | Ga0466704_282969 | 3300042643 | Bacteria | 8623 |
| 122 | IMNBL1DRAFT_c0001920 | 3300000062 | Bacteria | 15041 |
| 123 | Ga0068305_10007404 | 3300005083 | Bacteria | 89340 |
| 124 | Ga0102734_1000260 | 3300007129 | Unclassified | 16440 |
| 125 | Ga0102740_1000787 | 3300007140 | Unclassified | 9039 |
| 126 | Ga0466715_017736 | 3300042616 | Bacteria | 12115 |
| 127 | Ga0466715_166813 | 3300042616 | Bacteria | 19403 |
| 128 | Ga0466715_509861 | 3300042616 | Bacteria | 18242 |
| 129 | Ga0466726_070124 | 3300042619 | Bacteria | 2802 |
| 130 | Ga0466728_327607 | 3300042620 | Bacteria | 29712 |
| 131 | Ga0466729_060358 | 3300042621 | Bacteria | 13859 |
| 132 | Ga0466706_050698 | 3300042599 | Bacteria | 48334 |
| 133 | Ga0466706_247853 | 3300042599 | Bacteria | 2284 |
| 134 | Ga0466713_035424 | 3300042602 | Bacteria | 10259 |
| 135 | Ga0466713_107765 | 3300042602 | Bacteria | 14668 |
| 136 | Ga0466716_174387 | 3300042605 | Bacteria | 24121 |
| 137 | Ga0466716_280211 | 3300042605 | Bacteria | 5823 |
| 138 | Ga0466716_357046 | 3300042605 | Bacteria | 8030 |
| 139 | Ga0466722_032322 | 3300042609 | Bacteria | 11017 |
| 140 | Ga0466722_249809 | 3300042609 | Bacteria | 7232 |
| 141 | Ga0466692_172707 | 3300042591 | Bacteria | 15335 |
| 142 | Ga0466696_114042 | 3300042596 | Bacteria | 8252 |
| 143 | Ga0466696_162075 | 3300042596 | Bacteria | 29425 |
| 144 | Ga0466703_291687 | 3300042636 | Bacteria | 9949 |
| 145 | Ga0466704_477462 | 3300042643 | Bacteria | 10469 |
| 146 | Ga0466724_24871 | 3300042649 | Bacteria | 3437 |
| 147 | Ga0466708_095257 | 3300042652 | Bacteria | 18757 |
| 148 | Ga0123357_10138704 | 3300009784 | Bacteria | 2997 |
| 149 | Ga0123356_10027402 | 3300010049 | Bacteria | 5340 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF19572 | PorV | Type IX secretion system protein PorV | 58 | 294 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.