Protein Family IF04705
Metagenome
Isolate
249
Members
71
Samples
226
Scaffolds
363.1
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_156682|Ga0466692_156682_360_1595
- Length
- 411 aa
- Sequence
- LTLEKIFRTFVVIINFENEACSGYCIRLYYMFDKIKPNKALLPLSWLYGIGVWLRNKLFDWKILPVEKFDIPVISIGNLAVGGTGKTPHTEYIIRLLNRKYRVAVLSRGYKRETRGFILADKNADSRSIGDEPYQMYRKFPDIMVAVDSDRRRGIRNLMDFPKIQRPEVILLDDAFQHRYVKPSLSILLTDSRNPFYEDYLLPAGCLREPAKNCNRADIIIFTKCDKELQITKQYSALDKYKLQKHLSNAEYCFSIFNSKFSYKGLLPVFPEKNSIQKENIERLKKESYSFLLIAGLAQPKDLIQYLGEYTTDLHSMIYLDHYDFSRKDIDEITNTFNRIRNKNKLIITSEKDAVRLMHNPDIREEIKGLIYYLPIEVVFKPEQEELFTQKIENHVRNFKRNRIMAEAADT
Sample Types
Isolate
9.2%
Metagenome
90.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
27.1%
Kalotermitidae
20.0%
Unclassified
17.1%
Blattidae
12.9%
Rhinotermitidae
7.1%
Termopsidae
5.7%
Passalidae
4.3%
Hydrophilidae
2.9%
Tenebrionidae
1.4%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
241
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 2 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 3 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 4 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 9 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 10 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 11 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 12 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 13 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 14 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 18 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 19 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 24 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 25 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 26 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 27 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 28 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 29 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 30 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 31 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 32 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 33 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 34 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 37 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 38 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 40 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 41 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 42 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 43 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 44 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 45 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 46 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 47 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 48 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 49 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 50 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 51 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 52 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 53 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 54 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 55 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 56 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 57 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 58 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 59 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 60 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 61 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 62 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 63 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 64 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 65 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 66 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 67 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 68 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 69 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 70 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 71 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_227456 | 3300042611 | Bacteria | 2102 |
| 2 | Ga0466706_177039 | 3300042599 | Bacteria | 7297 |
| 3 | Ga0466700_051947 | 3300042600 | Bacteria | 66586 |
| 4 | Ga0466700_280339 | 3300042600 | Bacteria | 3559 |
| 5 | Ga0466707_150901 | 3300042601 | Bacteria | 2513 |
| 6 | Ga0466713_018889 | 3300042602 | Bacteria | 5627 |
| 7 | Ga0466716_475700 | 3300042605 | Bacteria | 19107 |
| 8 | Ga0466719_148058 | 3300042606 | Bacteria | 10372 |
| 9 | Ga0466722_115481 | 3300042609 | Bacteria | 8318 |
| 10 | Ga0466690_021160 | 3300042590 | Bacteria | 34990 |
| 11 | Ga0466690_283705 | 3300042590 | Bacteria | 9499 |
| 12 | Ga0466694_367000 | 3300042594 | Bacteria | 2999 |
| 13 | Ga0466701_002327 | 3300042598 | Bacteria | 1717 |
| 14 | Ga0123357_10045775 | 3300009784 | Bacteria | 5934 |
| 15 | Ga0123357_10086309 | 3300009784 | Bacteria | 4106 |
| 16 | Ga0123353_10347587 | 3300010167 | Bacteria | 2236 |
| 17 | Ga0466735_112479 | 3300042624 | Bacteria | 2099 |
| 18 | Ga0466703_085103 | 3300042636 | Bacteria | 2144 |
| 19 | Ga0466704_067608 | 3300042643 | Bacteria | 32121 |
| 20 | Ga0466708_062073 | 3300042652 | Bacteria | 36526 |
| 21 | 2227075521 | 2225789003 | Unclassified | 2293 |
| 22 | IMNBL1DRAFT_c0000258 | 3300000062 | Bacteria | 46723 |
| 23 | Ga0466711_021216 | 3300042615 | Bacteria | 14708 |
| 24 | Ga0466711_480260 | 3300042615 | Bacteria | 18028 |
| 25 | Ga0466723_245886 | 3300042618 | Bacteria | 7994 |
| 26 | Ga0466726_028385 | 3300042619 | Bacteria | 10985 |
| 27 | Ga0466728_163379 | 3300042620 | Bacteria | 4069 |
| 28 | Ga0466705_138190 | 3300042612 | Bacteria | 4545 |
| 29 | Ga0466706_065550 | 3300042599 | Bacteria | 22203 |
| 30 | Ga0466706_281573 | 3300042599 | Bacteria | 5106 |
| 31 | Ga0466719_169018 | 3300042606 | Bacteria | 7064 |
| 32 | Ga0466690_002652 | 3300042590 | Bacteria | 11712 |
| 33 | Ga0466692_063786 | 3300042591 | Bacteria | 32372 |
| 34 | Ga0466692_164974 | 3300042591 | Bacteria | 10767 |
| 35 | Ga0466691_130185 | 3300042593 | Bacteria | 9229 |
| 36 | Ga0466696_057822 | 3300042596 | Bacteria | 24547 |
| 37 | Ga0466696_068913 | 3300042596 | Bacteria | 44042 |
| 38 | Ga0466696_204887 | 3300042596 | Bacteria | 14398 |
| 39 | Ga0123357_10007092 | 3300009784 | Bacteria | 13795 |
| 40 | Ga0123353_10244040 | 3300010167 | Bacteria | 2788 |
| 41 | Ga0123354_10005918 | 3300010882 | Bacteria | 17982 |
| 42 | Ga0123354_10027063 | 3300010882 | Bacteria | 9038 |
| 43 | Ga0466703_381909 | 3300042636 | Bacteria | 7072 |
| 44 | Ga0466704_265736 | 3300042643 | Bacteria | 4158 |
| 45 | Ga0466704_379994 | 3300042643 | Bacteria | 5835 |
| 46 | Ga0466704_446725 | 3300042643 | Bacteria | 7921 |
| 47 | Ga0466709_047096 | 3300042648 | Bacteria | 173163 |
| 48 | Ga0466709_231961 | 3300042648 | Bacteria | 4863 |
| 49 | Ga0466709_394008 | 3300042648 | Bacteria | 4362 |
| 50 | Ga0466708_129871 | 3300042652 | Bacteria | 5352 |
| 51 | IMNBL1DRAFT_c0003656 | 3300000062 | Bacteria | 9698 |
| 52 | Ga0068305_10245241 | 3300005083 | Bacteria | 3298 |
| 53 | Ga0466711_133120 | 3300042615 | Bacteria | 15086 |
| 54 | Ga0466715_053969 | 3300042616 | Bacteria | 25316 |
| 55 | Ga0466715_172433 | 3300042616 | Bacteria | 26174 |
| 56 | Ga0466715_374572 | 3300042616 | Bacteria | 13915 |
| 57 | Ga0466705_386357 | 3300042612 | Bacteria | 5544 |
| 58 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 59 | Ga0466701_083460 | 3300042598 | Bacteria | 23632 |
| 60 | Ga0466707_099479 | 3300042601 | Bacteria | 13570 |
| 61 | Ga0466713_087424 | 3300042602 | Bacteria | 3142 |
| 62 | Ga0466719_261306 | 3300042606 | Bacteria | 8701 |
| 63 | Ga0466722_153847 | 3300042609 | Bacteria | 9576 |
| 64 | Ga0466690_126851 | 3300042590 | Bacteria | 8698 |
| 65 | Ga0466692_188699 | 3300042591 | Bacteria | 17050 |
| 66 | Ga0466694_373619 | 3300042594 | Unclassified | 1414 |
| 67 | Ga0466696_142376 | 3300042596 | Bacteria | 2055 |
| 68 | Ga0123357_10066713 | 3300009784 | Bacteria | 4797 |
| 69 | Ga0123354_10034100 | 3300010882 | Bacteria | 7962 |
| 70 | Ga0466729_308243 | 3300042621 | Bacteria | 4762 |
| 71 | Ga0466731_059993 | 3300042622 | Bacteria | 1129 |
| 72 | Ga0466703_044273 | 3300042636 | Bacteria | 12367 |
| 73 | Ga0466703_166849 | 3300042636 | Bacteria | 14640 |
| 74 | Ga0466704_301132 | 3300042643 | Bacteria | 15813 |
| 75 | Ga0466708_028462 | 3300042652 | Bacteria | 25947 |
| 76 | Ga0466708_162451 | 3300042652 | Bacteria | 14489 |
| 77 | Ga0466727_029217 | 3300042655 | Bacteria | 11764 |
| 78 | IMNBL1DRAFT_c0001329 | 3300000062 | Bacteria | 18611 |
| 79 | IMNBL1DRAFT_c0008193 | 3300000062 | Bacteria | 5360 |
| 80 | JGI24702J35022_10013346 | 3300002462 | Bacteria | 4553 |
| 81 | Ga0466711_106300 | 3300042615 | Bacteria | 14844 |
| 82 | Ga0466715_030319 | 3300042616 | Bacteria | 43703 |
| 83 | Ga0466715_338052 | 3300042616 | Bacteria | 3342 |
| 84 | Ga0466723_170719 | 3300042618 | Bacteria | 19996 |
| 85 | Ga0466726_225590 | 3300042619 | Bacteria | 6656 |
| 86 | Ga0466705_038921 | 3300042612 | Bacteria | 7236 |
| 87 | Ga0466733_012960 | 3300042659 | Bacteria | 20856 |
| 88 | Ga0466733_051389 | 3300042659 | Bacteria | 26062 |
| 89 | Ga0466706_038864 | 3300042599 | Bacteria | 36489 |
| 90 | Ga0466706_142486 | 3300042599 | Bacteria | 3341 |
| 91 | Ga0466707_242973 | 3300042601 | Bacteria | 16990 |
| 92 | Ga0466713_004833 | 3300042602 | Bacteria | 2984 |
| 93 | Ga0466713_021496 | 3300042602 | Bacteria | 25913 |
| 94 | Ga0466713_095311 | 3300042602 | Bacteria | 20714 |
| 95 | Ga0466713_102098 | 3300042602 | Bacteria | 100663 |
| 96 | Ga0466716_113517 | 3300042605 | Bacteria | 1461 |
| 97 | Ga0466716_165798 | 3300042605 | Bacteria | 21702 |
| 98 | Ga0466719_410926 | 3300042606 | Bacteria | 5360 |
| 99 | Ga0466722_104075 | 3300042609 | Bacteria | 4021 |
| 100 | Ga0466691_061944 | 3300042593 | Bacteria | 2688 |
| 101 | Ga0123357_10094236 | 3300009784 | Bacteria | 3888 |
| 102 | Ga0123357_10298621 | 3300009784 | Bacteria | 1631 |
| 103 | Ga0123357_10337079 | 3300009784 | Unclassified | 1464 |
| 104 | Ga0123353_10351385 | 3300010167 | Bacteria | 2221 |
| 105 | Ga0123354_10195521 | 3300010882 | Bacteria | 2246 |
| 106 | Ga0466735_006002 | 3300042624 | Bacteria | 11022 |
| 107 | Ga0466735_214437 | 3300042624 | Bacteria | 5879 |
| 108 | Ga0466709_285424 | 3300042648 | Bacteria | 5177 |
| 109 | Ga0466709_397404 | 3300042648 | Bacteria | 20612 |
| 110 | JGI24699J35502_11133744 | 3300002509 | Bacteria | 14678 |
| 111 | JGI24699J35502_11134139 | 3300002509 | Bacteria | 36268 |
| 112 | Ga0466715_016723 | 3300042616 | Bacteria | 13247 |
| 113 | Ga0466715_172153 | 3300042616 | Bacteria | 6972 |
| 114 | Ga0466715_566191 | 3300042616 | Bacteria | 17032 |
| 115 | Ga0466726_305016 | 3300042619 | Bacteria | 6879 |
| 116 | Ga0466726_460568 | 3300042619 | Bacteria | 1858 |
| 117 | Ga0466705_080945 | 3300042612 | Bacteria | 8804 |
| 118 | Ga0466732_303299 | 3300042656 | Bacteria | 2087 |
| 119 | Ga0466733_125393 | 3300042659 | Bacteria | 4247 |
| 120 | Ga0466701_076335 | 3300042598 | Bacteria | 60822 |
| 121 | Ga0466706_014339 | 3300042599 | Bacteria | 1465 |
| 122 | Ga0466707_403051 | 3300042601 | Bacteria | 38545 |
| 123 | Ga0466713_008757 | 3300042602 | Bacteria | 124939 |
| 124 | Ga0466716_098578 | 3300042605 | Bacteria | 13248 |
| 125 | Ga0466719_187312 | 3300042606 | Bacteria | 7562 |
| 126 | Ga0466690_092145 | 3300042590 | Bacteria | 4805 |
| 127 | Ga0466696_061780 | 3300042596 | Bacteria | 15826 |
| 128 | Ga0466696_130574 | 3300042596 | Bacteria | 2286 |
| 129 | Ga0123356_10005793 | 3300010049 | Bacteria | 12540 |
| 130 | Ga0123354_10190664 | 3300010882 | Bacteria | 2297 |
| 131 | Ga0466729_239194 | 3300042621 | Bacteria | 6686 |
| 132 | Ga0466703_066400 | 3300042636 | Bacteria | 3127 |
| 133 | Ga0466704_618815 | 3300042643 | Bacteria | 4565 |
| 134 | Ga0466709_219231 | 3300042648 | Bacteria | 38332 |
| 135 | Ga0466727_051071 | 3300042655 | Bacteria | 7387 |
| 136 | 2227183573 | 2225789004 | Bacteria | 8038 |
| 137 | IMNBL1DRAFT_c0000845 | 3300000062 | Bacteria | 24026 |
| 138 | IMNBL1DRAFT_c0006582 | 3300000062 | Bacteria | 6315 |
| 139 | Ga0068302_10111128 | 3300005071 | Bacteria | 2886 |
| 140 | Ga0123357_10000278 | 3300009784 | Bacteria | 48976 |
| 141 | Ga0466728_137650 | 3300042620 | Bacteria | 24071 |
| 142 | Ga0466728_394624 | 3300042620 | Bacteria | 1627 |
| 143 | Ga0466705_058171 | 3300042612 | Bacteria | 7337 |
| 144 | Ga0466705_162975 | 3300042612 | Bacteria | 5746 |
| 145 | Ga0466706_251697 | 3300042599 | Bacteria | 30849 |
| 146 | Ga0466700_345535 | 3300042600 | Bacteria | 6245 |
| 147 | Ga0466707_014217 | 3300042601 | Bacteria | 6002 |
| 148 | Ga0466707_262274 | 3300042601 | Bacteria | 8978 |
| 149 | Ga0466713_016019 | 3300042602 | Bacteria | 439221 |
| 150 | Ga0466713_078638 | 3300042602 | Bacteria | 24003 |
| 151 | Ga0466713_110341 | 3300042602 | Bacteria | 68993 |
| 152 | Ga0466722_135071 | 3300042609 | Bacteria | 5773 |
| 153 | Ga0466656_384313 | 3300042550 | Bacteria | 1367 |
| 154 | Ga0466690_099393 | 3300042590 | Bacteria | 94849 |
| 155 | Ga0466692_156682 | 3300042591 | Bacteria | 1985 |
| 156 | Ga0466693_073899 | 3300042592 | Unclassified | 1218 |
| 157 | Ga0466696_042937 | 3300042596 | Bacteria | 5354 |
| 158 | Ga0123357_10173592 | 3300009784 | Bacteria | 2541 |
| 159 | Ga0123356_10171788 | 3300010049 | Bacteria | 2179 |
| 160 | Ga0123354_10000458 | 3300010882 | Bacteria | 40359 |
| 161 | Ga0123354_10097362 | 3300010882 | Bacteria | 4010 |
| 162 | Ga0466703_177758 | 3300042636 | Bacteria | 25094 |
| 163 | Ga0466703_348019 | 3300042636 | Bacteria | 9087 |
| 164 | Ga0466709_056582 | 3300042648 | Bacteria | 2000 |
| 165 | Ga0466725_333353 | 3300042654 | Bacteria | 16822 |
| 166 | 2227535784 | 2225789004 | Bacteria | 3071 |
| 167 | JGI24699J35502_11134155 | 3300002509 | Bacteria | 38447 |
| 168 | JGI24696J40584_12957391 | 3300002834 | Bacteria | 3492 |
| 169 | Ga0466711_239428 | 3300042615 | Bacteria | 25320 |
| 170 | Ga0466723_053026 | 3300042618 | Bacteria | 3517 |
| 171 | Ga0466697_118709 | 3300042611 | Bacteria | 2520 |
| 172 | Ga0466705_155822 | 3300042612 | Bacteria | 8396 |
| 173 | Ga0466733_017534 | 3300042659 | Bacteria | 6126 |
| 174 | Ga0466700_198375 | 3300042600 | Bacteria | 7072 |
| 175 | Ga0466707_087285 | 3300042601 | Bacteria | 3810 |
| 176 | Ga0466707_264149 | 3300042601 | Bacteria | 20322 |
| 177 | Ga0466713_015725 | 3300042602 | Bacteria | 8164 |
| 178 | Ga0466713_104091 | 3300042602 | Bacteria | 19037 |
| 179 | Ga0466713_126275 | 3300042602 | Bacteria | 2631 |
| 180 | Ga0466722_071261 | 3300042609 | Bacteria | 2739 |
| 181 | Ga0466722_165038 | 3300042609 | Bacteria | 15678 |
| 182 | Ga0466698_038022 | 3300042610 | Bacteria | 1846 |
| 183 | Ga0466691_051351 | 3300042593 | Bacteria | 7659 |
| 184 | Ga0123353_10130726 | 3300010167 | Bacteria | 4029 |
| 185 | Ga0123353_10271733 | 3300010167 | Bacteria | 2611 |
| 186 | Ga0123353_10429281 | 3300010167 | Unclassified | 1955 |
| 187 | Ga0466735_179189 | 3300042624 | Bacteria | 8297 |
| 188 | Ga0466704_264096 | 3300042643 | Bacteria | 4160 |
| 189 | Ga0466704_377628 | 3300042643 | Bacteria | 36522 |
| 190 | Ga0466704_464686 | 3300042643 | Bacteria | 6261 |
| 191 | Ga0466708_043653 | 3300042652 | Bacteria | 9633 |
| 192 | Ga0466708_055325 | 3300042652 | Bacteria | 12591 |
| 193 | Ga0466727_104042 | 3300042655 | Bacteria | 28997 |
| 194 | Ga0466727_166903 | 3300042655 | Bacteria | 44044 |
| 195 | 2227506586 | 2225789004 | Bacteria | 3656 |
| 196 | IMNBL1DRAFT_c0001967 | 3300000062 | Unclassified | 14803 |
| 197 | Ga0068302_10037447 | 3300005071 | Bacteria | 4796 |
| 198 | Ga0466711_111006 | 3300042615 | Bacteria | 9788 |
| 199 | Ga0466711_198132 | 3300042615 | Bacteria | 7237 |
| 200 | Ga0466728_436063 | 3300042620 | Bacteria | 24967 |
| 201 | Ga0466733_043571 | 3300042659 | Bacteria | 53516 |
| 202 | Ga0466707_195517 | 3300042601 | Bacteria | 16368 |
| 203 | Ga0466713_098571 | 3300042602 | Bacteria | 8803 |
| 204 | Ga0466713_127966 | 3300042602 | Bacteria | 3328 |
| 205 | Ga0466716_198605 | 3300042605 | Bacteria | 6026 |
| 206 | Ga0466722_021821 | 3300042609 | Bacteria | 4912 |
| 207 | Ga0466693_239265 | 3300042592 | Unclassified | 2246 |
| 208 | Ga0466695_137726 | 3300042595 | Bacteria | 2304 |
| 209 | Ga0466735_043159 | 3300042624 | Bacteria | 14323 |
| 210 | Ga0466735_092502 | 3300042624 | Bacteria | 1941 |
| 211 | Ga0466703_002530 | 3300042636 | Bacteria | 34046 |
| 212 | Ga0466703_047993 | 3300042636 | Bacteria | 11268 |
| 213 | Ga0466703_114630 | 3300042636 | Bacteria | 39473 |
| 214 | Ga0466703_153833 | 3300042636 | Bacteria | 1759 |
| 215 | Ga0466703_427374 | 3300042636 | Bacteria | 2716 |
| 216 | Ga0466704_010460 | 3300042643 | Bacteria | 15991 |
| 217 | Ga0466704_205936 | 3300042643 | Bacteria | 9806 |
| 218 | Ga0466704_463287 | 3300042643 | Bacteria | 3801 |
| 219 | 2226985938 | 2225789003 | Bacteria | 7972 |
| 220 | 2227527430 | 2225789004 | Unclassified | 3218 |
| 221 | Ga0123357_10002653 | 3300009784 | Bacteria | 20125 |
| 222 | Ga0466711_048607 | 3300042615 | Bacteria | 5304 |
| 223 | Ga0466715_312952 | 3300042616 | Bacteria | 1489 |
| 224 | Ga0466715_581170 | 3300042616 | Bacteria | 23729 |
| 225 | Ga0466723_059578 | 3300042618 | Bacteria | 3569 |
| 226 | Ga0466723_254234 | 3300042618 | Bacteria | 3318 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02606 | LpxK | Tetraacyldisaccharide-1-P 4'-kinase | 40 | 392 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.