Protein Family IF04678
Metagenome
Isolate
171
Members
60
Samples
151
Scaffolds
717.72
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_118411|Ga0466692_118411_24047_26656
- Length
- 856 aa
- Sequence
- VLLSGENAQKATCFVDGFPFCVRERLVAEIGIHPDFGRSYSPHSHSFMVQHHLLQLFASCPLFADATAGATAQAAGLDPKVLFWGVPGASFLALLFAFLFYKGMKNADPGTALMQKIAQHVREGAMAYLTQQYKVVGLFFIVLTGVFAWLAYGMGIQNKWVPFAFITGGFFSGLAGFFGMKTATYASSRVAAAAQKSLNSGLQVAFRSGAVMGLVVVGLALLDISIWFLVLNHFIEDSPQKLTVITTTMLTFGMGASLQALFARVGGGIYTKAADVGADLAGKVVAGLNEDDPNNPATIADADLYESYAGSILATAALGAAGVTAFGXIGAKAGLAADPNLGYKLVMAPMLIAAVGTVLSILGIYVVRTKEGATQRNLLAALAKGVNFSSILITALSFGVLYLLNVPNYLGIWGAIVTGLVAGIIIGKSTEYYTSQEYGPTKHIAANGETGPATVIISGIGVGMLSTAIPVVVISIGTALAYCFASGDWHFAPESMAAGLYGIGIAAVGMLSTLGITLATDAYGPIADNAGGNAEMGRLPAEVRKRTDALDALGNTTAATGKGFAIGSAALTALALLASYVEELKIAMHHVLEPVFGKDGVAAATFGQFLVWDKDHAATAEAIKTGTSGHATDGVAIASANLTQFMDFFQVNLMNPKVIIGLFIGAMMSFLFCGLTMNAVGRAAKSMVQEICRQFRNAGILDAGNKVVEKFRNKEGTIDFPEGFTPDYATCVGISTRGAQREMVVPSLIAVVVPILTGVVFGVPGVFGLLGGGLSAGFVLAVFMANAGGAWDNAKKYIEEGHHGGKRSEAHKATVIGDTVGDPFKDTSGPSLNILIKLMSMVSIVTAGVNIYITLL
Sample Types
Isolate
11.7%
Metagenome
88.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
28.3%
Termitidae
25.0%
Kalotermitidae
23.3%
Blattidae
10.0%
Rhinotermitidae
5.0%
Passalidae
3.3%
Termopsidae
3.3%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
166
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 3 | 2820018428 | Unclassified Spirochaetes Nt197P3bin33 | Isolate | Unclassified |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 14 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 15 | 2820016619 | Unclassified Spirochaetes Nt197P3bin71 | Isolate | Unclassified |
| 16 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 17 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 18 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 19 | 2940377351 | Ereboglobus sp. PH5-5 | Isolate | Blattidae |
| 20 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 21 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 22 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 23 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 24 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 25 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 26 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 27 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 28 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 29 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 32 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 33 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 37 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 38 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 39 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 40 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 41 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 42 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 43 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 44 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 45 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 52 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 53 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 54 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 55 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 56 | 2820831444 | Unclassified Actinobacteria Nc150P4bin21 | Isolate | Unclassified |
| 57 | 2940239174 | Ereboglobus sp. PH5-10 | Isolate | Blattidae |
| 58 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 59 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 60 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_004006 | 3300042659 | Bacteria | 20198 |
| 2 | Ga0466690_207162 | 3300042590 | Bacteria | 17260 |
| 3 | Ga0466690_292648 | 3300042590 | Bacteria | 7083 |
| 4 | Ga0466691_146428 | 3300042593 | Unclassified | 4732 |
| 5 | Ga0466696_231994 | 3300042596 | Bacteria | 8749 |
| 6 | Ga0466696_238108 | 3300042596 | Bacteria | 5416 |
| 7 | Ga0466707_152657 | 3300042601 | Bacteria | 24182 |
| 8 | Ga0466714_169924 | 3300042603 | Bacteria | 44877 |
| 9 | Ga0466716_086220 | 3300042605 | Bacteria | 79709 |
| 10 | Ga0466716_154143 | 3300042605 | Bacteria | 20045 |
| 11 | Ga0466720_190193 | 3300042607 | Bacteria | 11124 |
| 12 | Ga0466722_185267 | 3300042609 | Bacteria | 2636 |
| 13 | Ga0123356_10012204 | 3300010049 | Bacteria | 8351 |
| 14 | Ga0123353_10000014 | 3300010167 | Bacteria | 204767 |
| 15 | Ga0466731_266551 | 3300042622 | Bacteria | 3470 |
| 16 | Ga0466703_408191 | 3300042636 | Bacteria | 15894 |
| 17 | Ga0466703_424595 | 3300042636 | Bacteria | 3969 |
| 18 | Ga0466727_292959 | 3300042655 | Bacteria | 2528 |
| 19 | 2227535714 | 2225789004 | Bacteria | 63282 |
| 20 | Ga0466711_449989 | 3300042615 | Bacteria | 9021 |
| 21 | Ga0466728_261923 | 3300042620 | Bacteria | 5861 |
| 22 | Ga0466733_190994 | 3300042659 | Bacteria | 3648 |
| 23 | Ga0466690_043882 | 3300042590 | Unclassified | 21867 |
| 24 | Ga0466690_340070 | 3300042590 | Bacteria | 7261 |
| 25 | Ga0466696_266425 | 3300042596 | Bacteria | 54685 |
| 26 | Ga0466713_009751 | 3300042602 | Bacteria | 10633 |
| 27 | Ga0466713_090562 | 3300042602 | Bacteria | 7684 |
| 28 | Ga0466714_058710 | 3300042603 | Bacteria | 109931 |
| 29 | Ga0466717_022094 | 3300042604 | Bacteria | 2845 |
| 30 | Ga0466716_428069 | 3300042605 | Bacteria | 6481 |
| 31 | Ga0123356_10072728 | 3300010049 | Bacteria | 3231 |
| 32 | Ga0123353_10165977 | 3300010167 | Bacteria | 3509 |
| 33 | Ga0466703_117837 | 3300042636 | Bacteria | 9601 |
| 34 | Ga0466704_148253 | 3300042643 | Bacteria | 20299 |
| 35 | Ga0466709_039622 | 3300042648 | Bacteria | 20117 |
| 36 | Ga0466708_204370 | 3300042652 | Bacteria | 37607 |
| 37 | JGI24695J34938_10011242 | 3300002450 | Bacteria | 4834 |
| 38 | Ga0466715_297858 | 3300042616 | Bacteria | 6146 |
| 39 | Ga0466705_054211 | 3300042612 | Bacteria | 8753 |
| 40 | Ga0466690_417680 | 3300042590 | Bacteria | 7746 |
| 41 | Ga0466692_051289 | 3300042591 | Bacteria | 30117 |
| 42 | Ga0466691_014326 | 3300042593 | Bacteria | 7362 |
| 43 | Ga0466713_020992 | 3300042602 | Bacteria | 62959 |
| 44 | Ga0466713_100430 | 3300042602 | Bacteria | 8063 |
| 45 | Ga0466714_125685 | 3300042603 | Bacteria | 11617 |
| 46 | Ga0466719_354122 | 3300042606 | Bacteria | 56234 |
| 47 | Ga0466720_019857 | 3300042607 | Bacteria | 6249 |
| 48 | Ga0466731_382687 | 3300042622 | Bacteria | 13236 |
| 49 | IMNBL1DRAFT_c0000475 | 3300000062 | Bacteria | 33592 |
| 50 | JGI24702J35022_10000563 | 3300002462 | Bacteria | 22435 |
| 51 | JGI24702J35022_10003605 | 3300002462 | Bacteria | 9320 |
| 52 | Ga0466711_509301 | 3300042615 | Bacteria | 1915 |
| 53 | Ga0466715_072088 | 3300042616 | Bacteria | 72248 |
| 54 | Ga0466718_151327 | 3300042617 | Bacteria | 49244 |
| 55 | Ga0466723_096641 | 3300042618 | Bacteria | 6511 |
| 56 | Ga0466723_203179 | 3300042618 | Bacteria | 10673 |
| 57 | Ga0466728_295496 | 3300042620 | Bacteria | 96280 |
| 58 | Ga0466705_019972 | 3300042612 | Bacteria | 2736 |
| 59 | Ga0466733_092754 | 3300042659 | Bacteria | 31498 |
| 60 | Ga0466733_122810 | 3300042659 | Bacteria | 13318 |
| 61 | Ga0466656_136465 | 3300042550 | Bacteria | 11948 |
| 62 | Ga0466690_340128 | 3300042590 | Bacteria | 5951 |
| 63 | Ga0466691_048331 | 3300042593 | Bacteria | 54939 |
| 64 | Ga0466691_222518 | 3300042593 | Bacteria | 8798 |
| 65 | Ga0466696_005470 | 3300042596 | Bacteria | 13020 |
| 66 | Ga0466706_029968 | 3300042599 | Bacteria | 8452 |
| 67 | Ga0466706_042221 | 3300042599 | Bacteria | 2322 |
| 68 | Ga0466719_135694 | 3300042606 | Bacteria | 5218 |
| 69 | Ga0466704_159910 | 3300042643 | Unclassified | 10497 |
| 70 | Ga0466708_013812 | 3300042652 | Bacteria | 17831 |
| 71 | Ga0466715_135731 | 3300042616 | Bacteria | 13080 |
| 72 | Ga0466715_431438 | 3300042616 | Bacteria | 35345 |
| 73 | Ga0466715_629769 | 3300042616 | Bacteria | 55391 |
| 74 | Ga0466726_087810 | 3300042619 | Bacteria | 2542 |
| 75 | Ga0466690_147872 | 3300042590 | Bacteria | 9153 |
| 76 | Ga0466692_118411 | 3300042591 | Bacteria | 69710 |
| 77 | Ga0466696_371836 | 3300042596 | Bacteria | 9410 |
| 78 | Ga0466706_086537 | 3300042599 | Bacteria | 12006 |
| 79 | Ga0466720_124322 | 3300042607 | Bacteria | 18270 |
| 80 | Ga0466703_019944 | 3300042636 | Bacteria | 10718 |
| 81 | Ga0466703_207338 | 3300042636 | Bacteria | 2387 |
| 82 | Ga0466709_108250 | 3300042648 | Bacteria | 14580 |
| 83 | Ga0466709_182034 | 3300042648 | Bacteria | 4057 |
| 84 | Ga0466708_026866 | 3300042652 | Bacteria | 20807 |
| 85 | Ga0466708_241112 | 3300042652 | Unclassified | 3571 |
| 86 | Ga0466727_000346 | 3300042655 | Bacteria | 2649 |
| 87 | Ga0466727_052226 | 3300042655 | Bacteria | 15747 |
| 88 | Ga0466711_463590 | 3300042615 | Bacteria | 5622 |
| 89 | Ga0466715_039960 | 3300042616 | Bacteria | 44642 |
| 90 | Ga0466723_103492 | 3300042618 | Bacteria | 14835 |
| 91 | Ga0466723_169212 | 3300042618 | Bacteria | 16692 |
| 92 | Ga0466723_279912 | 3300042618 | Bacteria | 33283 |
| 93 | Ga0466726_010571 | 3300042619 | Bacteria | 5248 |
| 94 | Ga0466732_324983 | 3300042656 | Bacteria | 2341 |
| 95 | Ga0466696_115730 | 3300042596 | Bacteria | 9668 |
| 96 | Ga0466696_339196 | 3300042596 | Bacteria | 71315 |
| 97 | Ga0466696_426272 | 3300042596 | Bacteria | 2930 |
| 98 | Ga0466696_457291 | 3300042596 | Bacteria | 48176 |
| 99 | Ga0466707_038954 | 3300042601 | Bacteria | 5787 |
| 100 | Ga0466707_246922 | 3300042601 | Bacteria | 20410 |
| 101 | Ga0466714_168924 | 3300042603 | Bacteria | 42928 |
| 102 | Ga0466717_098479 | 3300042604 | Bacteria | 3647 |
| 103 | Ga0466722_029980 | 3300042609 | Bacteria | 9584 |
| 104 | Ga0466703_064776 | 3300042636 | Bacteria | 55980 |
| 105 | Ga0466703_233191 | 3300042636 | Bacteria | 10477 |
| 106 | Ga0466703_424561 | 3300042636 | Bacteria | 85024 |
| 107 | Ga0466704_035412 | 3300042643 | Bacteria | 12793 |
| 108 | Ga0466704_196131 | 3300042643 | Bacteria | 3359 |
| 109 | Ga0466704_418656 | 3300042643 | Bacteria | 5018 |
| 110 | Ga0466709_216689 | 3300042648 | Bacteria | 32337 |
| 111 | Ga0466725_048677 | 3300042654 | Bacteria | 5280 |
| 112 | Ga0466727_287908 | 3300042655 | Bacteria | 2900 |
| 113 | Ga0466715_180294 | 3300042616 | Bacteria | 21237 |
| 114 | Ga0466718_113134 | 3300042617 | Bacteria | 21690 |
| 115 | Ga0466728_128920 | 3300042620 | Bacteria | 22012 |
| 116 | Ga0466729_118941 | 3300042621 | Bacteria | 18876 |
| 117 | Ga0466733_086329 | 3300042659 | Bacteria | 16311 |
| 118 | Ga0466690_139114 | 3300042590 | Bacteria | 89408 |
| 119 | Ga0466690_345987 | 3300042590 | Bacteria | 4925 |
| 120 | Ga0466699_225475 | 3300042597 | Bacteria | 5049 |
| 121 | Ga0466706_058713 | 3300042599 | Bacteria | 36381 |
| 122 | Ga0466706_068107 | 3300042599 | Bacteria | 19027 |
| 123 | Ga0466722_261554 | 3300042609 | Bacteria | 74167 |
| 124 | Ga0123356_10097971 | 3300010049 | Bacteria | 2806 |
| 125 | Ga0123353_10086595 | 3300010167 | Bacteria | 5045 |
| 126 | Ga0466703_045500 | 3300042636 | Bacteria | 15417 |
| 127 | JGI24702J35022_10000346 | 3300002462 | Bacteria | 27413 |
| 128 | JGI24699J35502_11134203 | 3300002509 | Bacteria | 55646 |
| 129 | Ga0466711_388295 | 3300042615 | Bacteria | 24101 |
| 130 | Ga0466715_521599 | 3300042616 | Bacteria | 20532 |
| 131 | Ga0466723_042477 | 3300042618 | Bacteria | 16339 |
| 132 | Ga0466733_000764 | 3300042659 | Bacteria | 7249 |
| 133 | Ga0466690_118201 | 3300042590 | Bacteria | 5881 |
| 134 | Ga0466690_320170 | 3300042590 | Unclassified | 16684 |
| 135 | Ga0466691_072496 | 3300042593 | Bacteria | 10080 |
| 136 | Ga0466696_184153 | 3300042596 | Bacteria | 23807 |
| 137 | Ga0466706_028321 | 3300042599 | Bacteria | 102705 |
| 138 | Ga0466714_138662 | 3300042603 | Bacteria | 2794 |
| 139 | Ga0466719_503207 | 3300042606 | Bacteria | 13393 |
| 140 | Ga0466722_041514 | 3300042609 | Bacteria | 2538 |
| 141 | Ga0466722_104828 | 3300042609 | Bacteria | 47798 |
| 142 | Ga0466703_100743 | 3300042636 | Bacteria | 8242 |
| 143 | Ga0466703_108148 | 3300042636 | Bacteria | 9948 |
| 144 | Ga0466704_249708 | 3300042643 | Bacteria | 2830 |
| 145 | Ga0466704_556046 | 3300042643 | Bacteria | 110424 |
| 146 | Ga0466727_104742 | 3300042655 | Bacteria | 16342 |
| 147 | Ga0068305_10011075 | 3300005083 | Bacteria | 13915 |
| 148 | Ga0466715_028768 | 3300042616 | Bacteria | 5025 |
| 149 | Ga0466715_080044 | 3300042616 | Bacteria | 13072 |
| 150 | Ga0466723_015624 | 3300042618 | Bacteria | 8596 |
| 151 | Ga0466728_027424 | 3300042620 | Bacteria | 16928 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03030 | H_PPase | Inorganic H+ pyrophosphatase | 92 | 845 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.