Protein Family IF04651
Metagenome
Isolate
143
Members
48
Samples
139
Scaffolds
325.87
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_077488|Ga0466692_077488_246_1361
- Length
- 371 aa
- Sequence
- MFREMLNGRLAPERRARKANFFPDRRQASVLPSYNGRREQEEWMPGKMAEEKVRINRILMIDEAIRSGVFPTIAKLARKAEVTNRTIERDIEYLRDIYQAPIEYNYEKRGYYYSEPNFFIKSVILTEGELFSIALFDRLLEQYRNTPLEAALRRIFNKIIQSMPDRVTVDSGLLGPQVSVISDHQSFIDPEVFEDVFTALKTKRTVTFDYRPLQKTTYMKRTVDPYHAICQRGNWYFIGHCHDKNEPRMFSFSRVKNANLTEQHFTIPADFQPEAFFDKEMGVWASSHTPYTVELLINNEIGTYALERQWHDTQTVEQREDGSVYVSFTTTQIPEVLHWVLGQGHTVKALAPSELVEQIKAETEKVRGIYE
Sample Types
Isolate
2.8%
Metagenome
97.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.7%
Kalotermitidae
26.1%
Unclassified
13.0%
Rhinotermitidae
8.7%
Termopsidae
6.5%
Taxonomy
Archaea
3
Bacteria
111
Eukaryota
0
Viruses
1
Unclassified
28
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 10 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 11 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 12 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 13 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 14 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 18 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 25 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 26 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 37 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 38 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 39 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 40 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 41 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 42 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 43 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 44 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 47 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 48 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466703_189386 | 3300042636 | Bacteria | 14392 |
| 2 | Ga0466709_014946 | 3300042648 | Bacteria | 1909 |
| 3 | Ga0466727_134833 | 3300042655 | Bacteria | 5578 |
| 4 | Ga0466712_074888 | 3300042614 | Unclassified | 5418 |
| 5 | Ga0466712_288525 | 3300042614 | Bacteria | 10077 |
| 6 | Ga0466707_060841 | 3300042601 | Unclassified | 1294 |
| 7 | Ga0466720_090808 | 3300042607 | Bacteria | 2537 |
| 8 | Ga0466722_169315 | 3300042609 | Bacteria | 22756 |
| 9 | Ga0123355_10187590 | 3300009826 | Bacteria | 3054 |
| 10 | Ga0456237_0005000 | 3300041968 | Unclassified | 2114 |
| 11 | Ga0466694_306126 | 3300042594 | Bacteria | 1401 |
| 12 | AustNasuHG_c1017429 | 3300000089 | Bacteria | 2389 |
| 13 | JGI24695J34938_10001555 | 3300002450 | Bacteria | 19332 |
| 14 | JGI24695J34938_10014780 | 3300002450 | Archaea | 4028 |
| 15 | JGI24695J34938_10042695 | 3300002450 | Bacteria | 2027 |
| 16 | Ga0466705_096027 | 3300042612 | Unclassified | 10037 |
| 17 | Ga0466704_342375 | 3300042643 | Bacteria | 4229 |
| 18 | Ga0466727_287468 | 3300042655 | Unclassified | 1284 |
| 19 | Ga0466718_071266 | 3300042617 | Bacteria | 4982 |
| 20 | Ga0466718_105631 | 3300042617 | Bacteria | 1498 |
| 21 | Ga0466726_046339 | 3300042619 | Bacteria | 5468 |
| 22 | Ga0466726_401780 | 3300042619 | Bacteria | 1428 |
| 23 | Ga0466719_486434 | 3300042606 | Unclassified | 1556 |
| 24 | Ga0264413_147654 | 3300024493 | Bacteria | 2781 |
| 25 | Ga0466690_150020 | 3300042590 | Bacteria | 2106 |
| 26 | Ga0466699_418679 | 3300042597 | Bacteria | 1737 |
| 27 | JGI24700J35501_10930593 | 3300002508 | Bacteria | 16332 |
| 28 | Ga0072941_1035444 | 3300005201 | Bacteria | 2006 |
| 29 | Ga0466729_282643 | 3300042621 | Bacteria | 1304 |
| 30 | Ga0466707_057824 | 3300042601 | Bacteria | 3679 |
| 31 | Ga0466707_324333 | 3300042601 | Unclassified | 1691 |
| 32 | Ga0466722_081750 | 3300042609 | Bacteria | 1596 |
| 33 | Ga0123357_10032435 | 3300009784 | Bacteria | 7093 |
| 34 | Ga0466690_150067 | 3300042590 | Bacteria | 4547 |
| 35 | Ga0466692_092127 | 3300042591 | Bacteria | 12652 |
| 36 | Ga0466693_101393 | 3300042592 | Unclassified | 1160 |
| 37 | Ga0466694_102467 | 3300042594 | Bacteria | 3252 |
| 38 | JGI24695J34938_10008606 | 3300002450 | Bacteria | 5799 |
| 39 | JGI24705J35276_12186943 | 3300002504 | Bacteria | 1425 |
| 40 | Ga0072941_1063080 | 3300005201 | Bacteria | 7566 |
| 41 | Ga0466705_368747 | 3300042612 | Bacteria | 8162 |
| 42 | Ga0466735_114906 | 3300042624 | Bacteria | 2190 |
| 43 | Ga0466735_186514 | 3300042624 | Unclassified | 1904 |
| 44 | Ga0466702_093606 | 3300042635 | Bacteria | 2042 |
| 45 | Ga0466708_011600 | 3300042652 | Bacteria | 3618 |
| 46 | Ga0466727_176734 | 3300042655 | Bacteria | 10354 |
| 47 | Ga0466718_000567 | 3300042617 | Bacteria | 3786 |
| 48 | Ga0466718_153905 | 3300042617 | Bacteria | 1358 |
| 49 | Ga0466728_308390 | 3300042620 | Bacteria | 3073 |
| 50 | Ga0466728_427013 | 3300042620 | Bacteria | 1506 |
| 51 | Ga0466707_139745 | 3300042601 | Bacteria | 1808 |
| 52 | Ga0466707_348817 | 3300042601 | Bacteria | 1177 |
| 53 | Ga0466716_079170 | 3300042605 | Bacteria | 14484 |
| 54 | Ga0466716_245994 | 3300042605 | Bacteria | 9565 |
| 55 | Ga0466722_046653 | 3300042609 | Unclassified | 1254 |
| 56 | Ga0466694_042364 | 3300042594 | Bacteria | 4141 |
| 57 | Ga0466694_076625 | 3300042594 | Archaea | 5277 |
| 58 | Ga0466694_373400 | 3300042594 | Bacteria | 2759 |
| 59 | Ga0074263_112188 | 3300005485 | Unclassified | 1598 |
| 60 | Ga0466705_172084 | 3300042612 | Bacteria | 5876 |
| 61 | Ga0466702_115136 | 3300042635 | Bacteria | 1802 |
| 62 | Ga0466703_372571 | 3300042636 | Bacteria | 5901 |
| 63 | Ga0466703_382914 | 3300042636 | Bacteria | 3929 |
| 64 | Ga0466703_431794 | 3300042636 | Bacteria | 1928 |
| 65 | Ga0466709_274266 | 3300042648 | Bacteria | 3516 |
| 66 | Ga0466711_273206 | 3300042615 | Bacteria | 2249 |
| 67 | Ga0466728_197064 | 3300042620 | Bacteria | 1987 |
| 68 | Ga0466714_028898 | 3300042603 | Unclassified | 1050 |
| 69 | Ga0466716_297512 | 3300042605 | Unclassified | 1255 |
| 70 | Ga0466720_057328 | 3300042607 | Bacteria | 8165 |
| 71 | Ga0123356_10006677 | 3300010049 | Bacteria | 11625 |
| 72 | Ga0466690_108908 | 3300042590 | Bacteria | 1710 |
| 73 | Ga0466692_036799 | 3300042591 | Bacteria | 2465 |
| 74 | Ga0466694_013877 | 3300042594 | Bacteria | 13588 |
| 75 | Ga0466694_120149 | 3300042594 | Bacteria | 5391 |
| 76 | JGI24698J34947_10005502 | 3300002449 | Unclassified | 6951 |
| 77 | Ga0466733_204187 | 3300042659 | Bacteria | 1637 |
| 78 | Ga0466703_309732 | 3300042636 | Bacteria | 16614 |
| 79 | Ga0466704_187615 | 3300042643 | Bacteria | 12483 |
| 80 | Ga0466708_083056 | 3300042652 | Bacteria | 5168 |
| 81 | Ga0466727_328738 | 3300042655 | Bacteria | 1126 |
| 82 | Ga0466712_005963 | 3300042614 | Unclassified | 3139 |
| 83 | Ga0466712_182213 | 3300042614 | Unclassified | 1099 |
| 84 | Ga0466711_018392 | 3300042615 | Bacteria | 2812 |
| 85 | Ga0466711_209097 | 3300042615 | Bacteria | 10339 |
| 86 | Ga0466723_002136 | 3300042618 | Bacteria | 12629 |
| 87 | Ga0466728_459438 | 3300042620 | Bacteria | 5330 |
| 88 | Ga0466720_041592 | 3300042607 | Unclassified | 1628 |
| 89 | Ga0123356_10001816 | 3300010049 | Bacteria | 23215 |
| 90 | Ga0466695_053095 | 3300042595 | Bacteria | 28873 |
| 91 | JGI24698J34947_10081392 | 3300002449 | Bacteria | 1518 |
| 92 | JGI24705J35276_12164985 | 3300002504 | Bacteria | 1255 |
| 93 | Ga0466731_065974 | 3300042622 | Bacteria | 1154 |
| 94 | Ga0466735_005431 | 3300042624 | Bacteria | 1974 |
| 95 | Ga0466708_202657 | 3300042652 | Bacteria | 5550 |
| 96 | Ga0466712_154857 | 3300042614 | Bacteria | 19318 |
| 97 | Ga0466712_241815 | 3300042614 | Unclassified | 1230 |
| 98 | Ga0466711_215228 | 3300042615 | Bacteria | 2408 |
| 99 | Ga0466711_228285 | 3300042615 | Bacteria | 15441 |
| 100 | Ga0466711_298888 | 3300042615 | Bacteria | 1288 |
| 101 | Ga0466711_347349 | 3300042615 | Bacteria | 1959 |
| 102 | Ga0466726_314599 | 3300042619 | Unclassified | 1301 |
| 103 | Ga0466729_157526 | 3300042621 | Bacteria | 2259 |
| 104 | Ga0466707_162633 | 3300042601 | Bacteria | 3357 |
| 105 | Ga0466707_253773 | 3300042601 | Unclassified | 2249 |
| 106 | Ga0466713_007266 | 3300042602 | Bacteria | 1869 |
| 107 | Ga0466716_298256 | 3300042605 | Unclassified | 16880 |
| 108 | Ga0466719_172351 | 3300042606 | Unclassified | 1183 |
| 109 | Ga0466722_027316 | 3300042609 | Unclassified | 5777 |
| 110 | Ga0466698_267623 | 3300042610 | Viruses | 2876 |
| 111 | Ga0123356_10000072 | 3300010049 | Bacteria | 106738 |
| 112 | Ga0123356_10101359 | 3300010049 | Bacteria | 2762 |
| 113 | Ga0466690_319564 | 3300042590 | Unclassified | 1036 |
| 114 | Ga0466691_018018 | 3300042593 | Unclassified | 8263 |
| 115 | Ga0466694_130843 | 3300042594 | Bacteria | 1673 |
| 116 | Ga0466699_136674 | 3300042597 | Bacteria | 2717 |
| 117 | Ga0466699_441078 | 3300042597 | Bacteria | 1346 |
| 118 | JGI24698J34947_10000242 | 3300002449 | Bacteria | 22781 |
| 119 | JGI24698J34947_10025515 | 3300002449 | Unclassified | 3145 |
| 120 | JGI24698J34947_10032945 | 3300002449 | Bacteria | 2719 |
| 121 | Ga0072941_1002833 | 3300005201 | Bacteria | 36326 |
| 122 | Ga0466705_072814 | 3300042612 | Bacteria | 6828 |
| 123 | Ga0466704_303779 | 3300042643 | Bacteria | 22719 |
| 124 | Ga0466708_162144 | 3300042652 | Bacteria | 3712 |
| 125 | Ga0466708_186829 | 3300042652 | Unclassified | 1165 |
| 126 | Ga0466726_340021 | 3300042619 | Bacteria | 6075 |
| 127 | Ga0466707_388319 | 3300042601 | Bacteria | 2974 |
| 128 | Ga0466716_271037 | 3300042605 | Bacteria | 2055 |
| 129 | Ga0466719_156559 | 3300042606 | Bacteria | 1529 |
| 130 | Ga0466720_186585 | 3300042607 | Unclassified | 1390 |
| 131 | Ga0466722_150828 | 3300042609 | Bacteria | 2894 |
| 132 | Ga0466692_077488 | 3300042591 | Bacteria | 1968 |
| 133 | Ga0466692_126144 | 3300042591 | Bacteria | 2722 |
| 134 | Ga0466699_016573 | 3300042597 | Bacteria | 2157 |
| 135 | Ga0466699_179532 | 3300042597 | Bacteria | 13447 |
| 136 | Ga0466699_403235 | 3300042597 | Bacteria | 2196 |
| 137 | AustNasuHG_c1015367 | 3300000089 | Bacteria | 2584 |
| 138 | JGI24698J34947_10051616 | 3300002449 | Archaea | 2067 |
| 139 | Ga0072941_1016912 | 3300005201 | Bacteria | 7984 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13280 | WYL | WYL domain | 191 | 365 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.